SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006280 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006280
Domain Number 1 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000394
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000628
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 641-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000205
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000802
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000801
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 828-890
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000701
Family VWC domain 0.049
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006280
Domain Number - Region: 567-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000354
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 388-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0455
Family EGF-type module 0.0093
Further Details:      
 
Domain Number - Region: 160-320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0847
Family Growth factor receptor domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006280   Gene: ENSTGUG00000006079   Transcript: ENSTGUT00000006343
Sequence length 1193
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:24448457:24481568:1 gene:ENSTGUG00000006079 transcript:ENSTGUT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVTLASGQFELEILSMQNVNGELQNGNCCDGTRNPGDKKCTRDECDTYFKVCLKEYQSRV
TAGGPCSFGSKSTPVIGGNTFNLKYNRNNEKNRIVIPFSFAWPRSYTLLVEAWDYNDNST
NPDRIIEKASHSGMINPSRQWQTLKHNAGVAHFEYQIRVTCAEHYYGFGCNKFCRPRDDF
FTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTIPGECRCQYGWQGQYCDKCI
PHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPE
GYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCAPGWAGPTCTDNIDDCSPNPCGHG
GTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITGWSGHN
CDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEI
NGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYC
HENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLV
NDFFCECKNGWKGKTCHSRESQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNS
SCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGENWYRC
ECAPGFAGPDCRININECQSSPCAFGATCIDEINGYRCICPPGRSGPGCQEVTGRPCITS
VRVMPDGTKWDDDCNTCQCLNGKVTCSKVWCGPRPCVLHAKGPSECPAGHACVPVRDDHC
FTHPCAAVGECWPSNQQPVRTKCNSDSYYQDNCANITFTFNKEMMAPGLTTEHVCSELRN
LNILKNISVEYSIYITCEPSHLANNEIHVAISAEDIGEDENPIKDITDKIIDLVSKRDGN
NTLIAAVAEVRVQRRPAKSKTDFLVPLLSSVLTVAWICCLVTVFYWCIRKRRKQSSHTHT
ASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQ
QKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences H0Z6T1
ENSTGUP00000006280 59729.ENSTGUP00000006280 ENSTGUP00000006280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]