SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006282 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006282
Domain Number 1 Region: 543-631
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000439
Family WD40-repeat 0.061
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006282
Domain Number - Region: 32-227,405-441,503-629
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000107
Family Tricorn protease domain 2 0.025
Further Details:      
 
Domain Number - Region: 760-803,859-1062
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00432
Family Quinohemoprotein amine dehydrogenase B chain 0.059
Further Details:      
 
Domain Number - Region: 297-365
Classification Level Classification E-value
Superfamily Thermostable phytase (3-phytase) 0.0183
Family Thermostable phytase (3-phytase) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006282   Gene: ENSTGUG00000006082   Transcript: ENSTGUT00000006345
Sequence length 1218
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:5580893:5608495:-1 gene:ENSTGUG00000006082 transcript:ENSTGUT00000006345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLYNLTLQRATGISFAIHGNFSGTKQQEIVVSRGKILELLRPDPNTGKVHTLLTVEVFG
VIRSLMAFRLTGGTKDYIVVGSDSGRIVILEYQPSKNVFEKIHQETFGKSGCRRIVPGQY
LAVDPKGRAVMISAIEKQKLVYILNRDAAARLTISSPLEAHKANTLVYHVVGVDVGFENP
MFACLEMDYEEADNDPTGEAAANTQQTLTFYELDLGLNHVVRKYSEPLEEHGNFLITVPG
GSDGPSGVLICSENYITYKNFGDQPDIRCPIPRRRNDLDDPERGMIFVCSATHKTKSMFF
FLAQTEQGDIFKITLETDEDMVTEIRLKYFDTVPVAAAMCVLKTGFLFVASEFGNHYLYQ
IAHLGDDDEEPEFSSAMPLEEGDTFFFQPRPLKNLVLVDELDSLSPILCCQIADLANEDT
PQLYVACGRGPRSSLRVLRHGLEVSEMAVSELPGNPNAVWTVRRHVEDEFDAYIIVSFVN
ATLVLSIGETVEEVTDSGFLGTTPTLSCSLLGDDALVQVYPDGIRHIRADKRVNEWKTPG
KKTIVKCAVNQRQVVIALTGGELVYFEMDPSGQLNEYTERKEMSADVVCMSLANVPPGEQ
RSRFLAVGLVDNTVRIISLDPSDCLQPLSMQALPAQPESLCIVEMGGTEKQDELGERGSI
GFLYLNIGLQNGVLLRTVLDPVTGDLSDTRTRYLGSRPVKLFRVRMQGQEAVLAMSSRSW
LSYSYQSRFHLTPLSYETLEFASGFASEQCPEGIVAISTNTLRILALEKLGAVFNQVAFP
LQYTPRKFVIHPESNNLIIIETDHNAYTEATKAQRKQQMAEEMVEAAGEDERELAAEMAA
AFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTG
DEWYVLVGVAKDLILNPRSVAGGFVYTYKLVNSGEKLEFLHKTPVEEVPAAIAPFQGRVL
IGVGKLLRVYDLGKKKLLRKCENKKHIANYICGIQTIGHRVIVSDVQESFIWVRYKRNEN
QLIIFADDTYPRWVTTATLLDYDTVAGADKFGNICVVRLPPNTNDEVDEDPTGNKALWDR
GLLNGASQKAEVIMNYHVGETVLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHD
FFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVAEELDR
TPPEVSKKLEDIRTRYAF
Download sequence
Identical sequences H0Z6T3
ENSTGUP00000006282 ENSTGUP00000006282 59729.ENSTGUP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]