SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006283 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006283
Domain Number 1 Region: 133-203
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-21
Family SH3-domain 0.00066
Further Details:      
 
Domain Number 2 Region: 444-517
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-20
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 3 Region: 794-878
Classification Level Classification E-value
Superfamily SH3-domain 7.61e-18
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 4 Region: 197-261
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000236
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 5 Region: 13-74
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000101
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006283   Gene: ENSTGUG00000006100   Transcript: ENSTGUT00000006346
Sequence length 879
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:32910621:32992456:-1 gene:ENSTGUG00000006100 transcript:ENSTGUT00000006346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSNTRKMDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVSSRNELRCPECRT
LVDCGVDELPSNILLVRLLDGIKQRPRKPSAGGGTAGTNALRVPTNTVANCGSKDLQSSQ
VGQQQRVQARSPPVRGVPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEV
NGIHGFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDEN
WAEGMLADKIGIFPISYVEFNTAAKQLIELDKPSGSAVDSGEGTSGAAHNNSTQKHTDTK
KNTKKRHSFTSLTMSNKASQSSQNRHSMEISPPVLISSSNPTAAARISELTGLSCSAPSQ
VHIGTTGLIVTPPPSSPVTTGPSFTFPSEVTYQAALGNMNPPLPPPPLLSAAIIASATSG
PQSTSVIQRSASGSTDQVAHLRQQTRPSVYIAIYPYTPRKEDELELRKGEMFLVFERCQD
GWFKGTSMHTSKIGVFPGNYVAPVTRTVTSASQTKVPMSTAGQTGRVVTMVSPSTASGTS
QKLQGNGVAVNSSTVPTAVVSAAHIQTSPQTKVLMHVTGQMTVNQARNAVRTVASHSQER
PTAAVTPIQAQNPSCLIPAAVIIPHHSVASQQLQPQLPNTAAYVTAVNVNRSTIPLACTA
ASLNSPNIAASSLEGDISGKTANTHPGAPASPESALTAGGSAAVSKTDKDGKKEKKGLLK
LLSGASTKRKPRPSPPASPTLEAEQAAAELALQGAVGPELPSAGAHGKAGSCPGDGEGPA
LAQEGLHRKAAALDAPVPIAPPPRQPCSSLGPLLNESRPLVCERYRVVVSYPPQSEAELE
LKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Download sequence
Identical sequences H0Z6T4
ENSTGUP00000006283 59729.ENSTGUP00000006283 ENSTGUP00000006283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]