SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006286 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006286
Domain Number 1 Region: 2-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-40
Family SPRY domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006286   Gene: ENSTGUG00000006110   Transcript: ENSTGUT00000006349
Sequence length 553
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:71252386:71290025:1 gene:ENSTGUG00000006110 transcript:ENSTGUT00000006349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSA
QGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTK
NGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQAQIDRF
PIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLA
GRMGEAIETTQQLYPSLLERNPNLLFALKVRQFIEMVNGTDSEVRCLGGHSPKSQDSYPV
SPRSFSSPSMSPSHGMNIHNLATGKGSSTHFTGFESSCSNGVISNKVHQSYCHSKHVTTS
LNVPELNNINVSRSQQVNSYSSNDVDMETDHYSNGVAETSSNGFLNGSSKHDHEMEECDT
EMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTVNKKMLKDAFSLLA
YSDPWSSPVGNQLDPIQREPVCSVLNSAILETHNLPKQPPLALAMGQASQCLGLMARSGI
GSCAFATVEDYLH
Download sequence
Identical sequences H0Z6T7
ENSTGUP00000006286 XP_002188250.1.42559 59729.ENSTGUP00000006286 ENSTGUP00000006286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]