SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006317 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006317
Domain Number 1 Region: 540-752
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-50
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 234-378
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-43
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 888-1031
Classification Level Classification E-value
Superfamily PH domain-like 4.82e-34
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 
Domain Number 4 Region: 737-861
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-30
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 133-233
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-28
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 6 Region: 53-133
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.09e-20
Family First domain of FERM 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006317   Gene: ENSTGUG00000006134   Transcript: ENSTGUT00000006381
Sequence length 1036
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:4653466:4720093:-1 gene:ENSTGUG00000006134 transcript:ENSTGUT00000006381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRILQTPGSRLGAQKTSGVSTLEPGQNLLTAMASSPAKAHERDLPVKIRMLDN
TVEVLDIESKCYGQTLLTEVYKHLNLIESDYFGIEVQNIQSYWIWLEPMKPVIKQVRRPK
TTMLRLAVKFFPPDPGQLQEEYTRYLFALQIKRDLAEERLTCSDNTAALLVSHLLQSEIG
DFDESEDQEHLKTNRYLPNQEKLEGKILEFHRKHVGQTPAESDFQVLEIARKLEMYGIRF
HLASDREGTKINLAVSHMGVLVFQGNTKINTFNWSKVRKLSFKRKRFLIKLHPEVCGPYQ
DTLEFLLGSRDECKNFWKICVEYHTFFRLFDQPKPKAKAVFFTRGSSFRYSGRTQKQLVD
YIKDSGMKRTPYERRHSKVRASTRTSNTDVPKQSVPFTEGLRTPGSPASTAAPLHSVHSL
TSPTSVLPMFAEPSPSSLDPRAPYTRIADKTTAAPVEEVGRKLMQQPGSPVLQGVGFGLP
VDHAQLSSLVLKSPLGLSPAFQVNAVTQGSSPLLSPVLSDAGGARIEEDDEMKRKRCPTD
KAYFIAKEILATERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFHRAFL
KEIEQRLSLWEGRSNAHMKGDFQRIGDVLLRNMRTLKEFTSYLQKHDEVLTELEKATKRL
KKLEMVYKEFELQKVCYLPLNTFLLKPIQRLMHYKLILGRLCKHYTAEHRDFADCRSALK
EVTEMTSQLQHSLIRLENFQKLTELQHDLIGIDNLTAPGREFIREGCLYKLTKKGLQQRM
FFLFSDMLLYTSKGVTGTNQFKIHGHLSLHGMLVEESENEWSVPHCFTIYSAQKTIVVAA
STRLEMGKWMEDLNVAIEMAKKSTEKSEMLLENSVCNRSNRSSDEVSVEQESEDDIHSSR
SSLDRQSHHRANTTMHVCWYRNTSVSMADHSAAVENQLSGYLLRKFKNSNGWQKLWVVFT
NFCLFFYKTHQDDYPLASLPLLGYTVSCPVEADGIQKDYVFKLQFKSHVYFFRAESKYTF
ERWMEVIKRATSSPAR
Download sequence
Identical sequences H0Z6W8
ENSTGUP00000006317 ENSTGUP00000006317 59729.ENSTGUP00000006317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]