SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006359 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006359
Domain Number 1 Region: 40-266
Classification Level Classification E-value
Superfamily L domain-like 8.33e-35
Family Ngr ectodomain-like 0.0037
Further Details:      
 
Domain Number 2 Region: 299-379
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000145
Family I set domains 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006359   Gene: ENSTGUG00000006197   Transcript: ENSTGUT00000006423
Sequence length 521
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:30596877:30598442:-1 gene:ENSTGUG00000006197 transcript:ENSTGUT00000006423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNWRTLPTRLGVFKANCKGLACLLVFTVSVCGSAPGMCPAACICASDIVSCTSKNLTR
VPGNLYKCMKRLDLSYNRIGILEPEWVPVLSEKLDTLIVNHNSISSISTGSFSTTPNLKY
LDLSSNSLKTLGSPVFQELKDLEVLLLYNNQITQIESLAFGGLYKLQKLYLSYNLVSHFP
LDLYIGKHKLTDLVLLDISFNHIQTMPVQRLSSVPAKQLSGIYLHGNPFYCDCVLYSMLV
FWYQRHFSSVVDFKNEYSCLLQSDPRGHNKLPLLHDNVMNCSESTVNSSFQAFGFIHDAQ
VGDRLIVHCDSRISDMGTQFVWVSPDNRLLEPDRDTDNFKVFPNGSLEITDAQLENSGLY
SCIAINKKRLLNETIEVKINVSNFTVNKSHAHEAFNTAFTTLAACVASIILVLLYLYLTP
CPCQCKAKKKKRKLNQSSAHPSILNSALPQELPADEKKASTGKRVVFLEPVHEPKQGQNG
KVKLFPNDSVITESILKTTRTKSDSDSVNSVFSDTPFMPPA
Download sequence
Identical sequences H0Z710
ENSTGUP00000006359 59729.ENSTGUP00000006359 ENSTGUP00000006359 XP_002196828.1.42559 XP_012424383.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]