SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006394 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006394
Domain Number 1 Region: 238-329
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.01e-22
Family Transforming growth factor (TGF)-beta 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006394   Gene: ENSTGUG00000006233   Transcript: ENSTGUT00000006458
Sequence length 330
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:10772704:10774697:1 gene:ENSTGUG00000006233 transcript:ENSTGUT00000006458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLHLLPAMLPTAALASCTGAGADRQLILAKVRARVLEHLSPPLLQEEPQMEARRVHR
RDVLENTEVEPEELEDTSQVILFPATDVPCEPTQPDKLLEEEGIFTYLFQPSAHTLSRVV
TSAQLWFYTGPSAGPQPLLPDVLTLSPQGRVPVTAMAERTPEHWTVFHLAPVLLPQLWQP
LFVLLVRCPGCPCLPEGDKMPFLVATTRAKGSERARRSAMPWSPAALSLLQRPSEELAAH
TNCRRASLNISFEELGWDKWIVHPSSFVFHYCHGSCAAGHGLSHRLGVQLCCAALPGTMR
SLRVRTTSDGGYSFKYETVPNILAQDCTCV
Download sequence
Identical sequences H0Z745
59729.ENSTGUP00000006394 XP_002196450.1.42559 ENSTGUP00000006394 ENSTGUP00000006394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]