SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006458 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006458
Domain Number 1 Region: 248-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000128
Family EGF-type module 0.007
Further Details:      
 
Domain Number 2 Region: 55-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000168
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 17-59
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000179
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 4 Region: 173-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000391
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 5 Region: 135-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000048
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 6 Region: 213-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000754
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 287-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000257
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 8 Region: 92-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family EGF-type module 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006458
Domain Number - Region: 1-23
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000507
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006458   Gene: ENSTGUG00000006290   Transcript: ENSTGUT00000006522
Sequence length 339
Comment pep:novel chromosome:taeGut3.2.4:9:4850729:4862776:-1 gene:ENSTGUG00000006290 transcript:ENSTGUT00000006522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTCSCLAGFTGKRCHVDVDECLSHPCQNGATCLNGAGRFTCRCPPGFRGNYCEIEVNECE
SSPCLNGGHCIDLVDNYTCVCLEPFVGQRCETDSSSCEDRSCQNRQTCNYIRPGRYICTC
SPGYYGNNCQYAMPSPCDSEPCLNGGSCKVHDDSYICECPQGFLGMHCEKGKPDPCASGP
CQNGGTCFHYIGKYKCDCPPGYTGRHCETVPSPCFLSPCENGATCEDLGGGYACTCSAGY
VGKHCQFEIDECQSQPCLNGGQCKDRVSSFLCLCEPGYTGYHCELASDPCFSSPCGSRGY
CLPSNGTHSCTCKVSYTGKNCEKEGQNCSKNPCRNGGTC
Download sequence
Identical sequences H0Z7A8
ENSTGUP00000006458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]