SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006463 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006463
Domain Number 1 Region: 668-978
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.2e-81
Family Protein kinases, catalytic subunit 0.0000000653
Further Details:      
 
Domain Number 2 Region: 140-237
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000101
Family Cadherin 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006463
Domain Number - Region: 6-84
Classification Level Classification E-value
Superfamily Cadherin-like 0.000228
Family Cadherin 0.012
Further Details:      
 
Domain Number - Region: 377-476
Classification Level Classification E-value
Superfamily Cadherin-like 0.000899
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006463   Gene: ENSTGUG00000006250   Transcript: ENSTGUT00000006527
Sequence length 1088
Comment pep:novel chromosome:taeGut3.2.4:6:10446406:10478636:-1 gene:ENSTGUG00000006250 transcript:ENSTGUT00000006527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGLYFPRKEYLENVYIDEPAGMPLLRIHALRDSHEEVAHFHLCQHLIVPRARPQENNW
FQIREKTGLLYLSKSLDREDFNMLSVGSWMPLSKVMLYVSVSHPFQEKDCDSATRTTVFL
SLINATAPACSSLTARQLCFTEMDLSFHIKENKPPGTFHQLQLPSVHHLCQNLSISYKLL
AAEGVPFRYNENTTSVRVTQRLDREERERYELIAKCTVREGFREMQVEVPFLVNVLDEDD
SPPFLPNGTDTADAVVEFNRKEGAVLSLTVYDADTTPIYPLESSRKKYTGTIITDDPWIS
ETFRVEHIFDEIHFSPNGSQVRGTRHEYKLVLNKSISVTEHRSFQLDVLVNDTEFHGPER
SVMLHFNVSILPVSIQFSNITYQFTVNRNAERFAQVGKICIENCMKFRGVNITYRLLSPN
SSCFPVSILQSREDKFGSLYVNDSSVLLRPECKEIQYTVQATDKQSRKHTKTLLTVVLEG
TLLNKEEDCPDSCAVSKHRAECEECGGLGVLTGRCQWRQGSGKGITTNYSTCTPSIRTCP
DGICDVVESRDPAVCPQDCTSGNIIGGHGKGIGNLGIKSGHGICYCFPRQNCYCEKDDIK
EQLCDDLCKTVITGAVVLCFVISVLVSFYCIHRYHKNAPKPPIASAEMTFRRPVQPYPIS
YSSSNVRRPSLDSMENQVSVDTFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRL
KGRAGYTTVAVKMLKENASQSELRDLLSEFNLLKQVNHPHVIKLYGACSQDGPLYLIVEY
AKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNPDERALTMGDLISFAWQISRGMQYLA
EMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDH
IYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLFNLLKTGYRMERPENCSEEMYSLMLR
CWKQEADKRPTFTEISKELEKMMVKSRDYLDLAASTPSDSLLYDDGLSEEETPLVDCNNA
PLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFDGTNSVFSRYANDSVYANWMVSHSAA
KFMDKFDS
Download sequence
Identical sequences H0Z7B3
ENSTGUP00000006463 ENSTGUP00000006463 59729.ENSTGUP00000006463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]