SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006486 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006486
Domain Number 1 Region: 324-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-34
Family SPRY domain 0.0018
Further Details:      
 
Domain Number 2 Region: 150-263
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000341
Family Fibronectin type III 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006486
Domain Number - Region: 1-60
Classification Level Classification E-value
Superfamily HP0062-like 0.0693
Family HP0062-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006486   Gene: ENSTGUG00000006307   Transcript: ENSTGUT00000006550
Sequence length 488
Comment pep:novel chromosome:taeGut3.2.4:Z:67711983:67729729:1 gene:ENSTGUG00000006307 transcript:ENSTGUT00000006550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETLQRIVSTLVNKNDEIRNFIDMLNHTLSNLQVNSFHAISELNEEFDGLYSVLHEMKESM
ANTIQQEEARKIQALQDQLRQCSCALENSEELLELAVRSLDIKDPVELLEVENIAWIVTV
ASAFRLSLKPKVSDSMTHMMVDFTLEKQMLQAVKFLPVPKAPEIDVAACLVADNCITMSW
RMPEEDSRIDHFVLEYRKTNFDGPPRLKGEQRWELVDYIKATQYTLSGLKFDTKYMNLRV
QACNKAVAGEYSDPVTLETKAFVFSLDSTSSHLNLKVEDTYVEWDSTGGKSQEKIKGKEN
KNTRTLSNTASPKRSTNSPRASARGSRDRFAGESYTVLGDTAIESGQHYWEVRAQKDCKS
YSVGVTYRNLGKFDQLGKTNSSWCIHINSWLQATFSAKHNNKAKTLDIPIPDRIGVYCDF
DGGQLSFYNASSKALLHTFRTKFTQPLLPGFMIWFGGLTVTTGLQVPSAVKTLQKSENGL
GGSTSSLN
Download sequence
Identical sequences H0Z7D6
ENSTGUP00000006486 59729.ENSTGUP00000006486 ENSTGUP00000006486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]