SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006573 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006573
Domain Number 1 Region: 4-183
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.25e-58
Family Eukaryotic proteases 0.00000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006573   Gene: ENSTGUG00000006401   Transcript: ENSTGUT00000006639
Sequence length 185
Comment pep:novel chromosome:taeGut3.2.4:11:5893177:5894693:-1 gene:ENSTGUG00000006401 transcript:ENSTGUT00000006639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKTDSVVVGAYDQDAPGPDQQELKIEKVFKNPRFNMLTIHDDITLIKLATPAQLSDRVSP
VCLPAATDEFPGGMTCVTTGWGLTDSSASDTPAVLQQAAVPLLTNAQCKEFWGFRIRDVM
VCAGADGASSCMGDSGGPLVCQRDGAWNLVGIVSWGSNTCDTKTPGVYARVTKLRGWIDS
ILEAN
Download sequence
Identical sequences H0Z7M3
ENSTGUP00000006573 59729.ENSTGUP00000006573 ENSTGUP00000006573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]