SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006578 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006578
Domain Number 1 Region: 143-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000962
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 2 Region: 177-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006578   Gene: ENSTGUG00000006410   Transcript: ENSTGUT00000006644
Sequence length 222
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:6696319:6697980:-1 gene:ENSTGUG00000006410 transcript:ENSTGUT00000006644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPVMLVELLFQAACVSLFLSSGQGRVYPTRKKPASFAVERRRVGPHVCFLGSGSGCCPGW
MLSPGSGKCTLPLCSFGCGGGSCIAPNLCMCPDGEQGITCPEPPGTCGEYGCDLSCNHGG
CQEVARVCPVGFSMAETANGVRCTDIDECQSAACEGTCVNTEGGFACECGAGRELSADRR
SCRDTDECQATPCQHRCENSVGSYRCSCRPGYHLHGNRHSCV
Download sequence
Identical sequences H0Z7M8
59729.ENSTGUP00000006578 ENSTGUP00000006578 ENSTGUP00000006578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]