SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006581 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006581
Domain Number 1 Region: 44-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.43e-22
Family Laminin G-like module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006581   Gene: ENSTGUG00000006382   Transcript: ENSTGUT00000006647
Sequence length 1650
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:12638237:12741483:1 gene:ENSTGUG00000006382 transcript:ENSTGUT00000006647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDVLHQLGLVKDVQEASETAVPSTSSLLPQGARLTASGVVLSIDAHIESRVAQVIPSNLG
HQFTLLVGLYSYRASDAFLFSVRNKSRLQFGVQLLPRKVAVYTGGKQPVSFDYCVHNEQW
HSFAIGIGDKTVSLFAECGNKYYSSEVLSEVGTFDSEAVFTLGRMNSHSVSFEGVICQLD
IIPSAEASANYCKYVKQQCRQAETYRSLRGASLLSHGLDAFSEMIIDEANQEDISAYRWK
EVSNMPVTNVAQIHFLPDHFELRNASVWEFAETKPLLLEAWPQTERQENMDLALQQQEMS
RKRNITKTPAGSYPNSSANTTGDAGRHREPSLISPLKQSKTKSKGKEKAKQHSDEPKKKQ
QIFNTTLYSLPAELTLDNQLHPGQKGAFDADETYHTENNYENGIDNYAYDYEDLGKIFER
GSVRGPKGETGPPGPPGPPGLPGPSGKRGPRGIPGPHGNPGLPGLPGPKGPKGDPGFSPG
RAKHGEKGDPGPMGFPGPPGIKGQKGLKGYPGLQGPRGEQGIPGMAGSIGAVGYPGRQGL
AGPEGNPGPKGVRGFIGPPGVAGQPGPEGERGIPGLRGKRGPKGRQGFPGDFGNRGPPGP
DGSPGIVGGVGPPGFPGLRGDMGPAGPSGPSGIPGPTGFPGSVGQPGMKGDKGEHGLAGD
PGDMGYPGDKGALGLPGPPGIRGKPGPPGKIGEPGPRGPLGPQGPEGFPGDIGVPGLNGP
EGPKGALGDRGPPGPQGPKGVEGEVGPAGPVGGVGPRGKPGQKGYVGDPGPEGLKGEQGD
QGNLGKTGEAGSAGLPGEAGTSGNLGDKGERGSPGPVGPPGEKGVMGYPGPPGGPGPVGP
EGLPGPSGARGPSGPQGAKGRRGPRGLDGPPGELGTEGIKGERGDPGKKGVPGLIGKAGN
PGEKGEQGGLGLLGPPGATGDRGPVGEPGPRGQPGEAGPIGEMGFEGPPGPEGEPGLQGE
PGTKGDIGPAGKVGEPGDQGLRGEPGPPGEDGVQGKDGPKGDPGDQGLAGEGGEKGEMGL
PGIAGPPGEPGLMGIPGPEGTPGNPGQRGRLGKKGEKGQLGPPGETGPAGDSGQPGKTGP
KGARGTRGPVGHLGGMGPEGEPGIPGYGGHQGPPGPSGPPGPKGEKGYPGEDNTIPGLPG
PIGEPGQSGERGDKGEPGDEGYKGYTGLPGHRGPIGQQGPPGEPGELGEQGLKGERGSEG
PTGKKGAPGQAGKAGVPGKPGPPGQTGIVGYPGPEGIPGNPGKTGLSGKPGPKGNKGNSG
LPGLAGYPGARGPKGLPGMPGPMGAPGLKGEKGLLGHPGKRGKRGLPGSPGDQGPAGATG
LKGQIGEDGDQGLMGFQGFPGPKGPAGDIGLVGILGPKGPTGQVGYIGPVGQEGIAGPTG
RPEFQHEYSYVNGAGPQGQPGQPGPPGPPGPPGPRKQVDLNAAVQALFESNAALQMEKYQ
NTEVTLLDHSTEIFKTLHYLSNLLHSIKNPLGTRDNPARICRDLLHCERKVSDGKYWIDP
NIGCPSDAIEVFCNFTAGGQTCLTPLSVTKLEFGVGKVQMNFLHLLSSEATHSITVHCLN
TPTWGLTRAGGRKTSVTFKGWNGQIFKANTLLEPKVLLDECMIEDGSWHKTQFFFHTQDT
NQLPVVQVNALPHLKPGQQHFIESGSVCFL
Download sequence
Identical sequences H0Z7N1
59729.ENSTGUP00000006581 ENSTGUP00000006581 ENSTGUP00000006581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]