SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006597 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006597
Domain Number 1 Region: 1-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.68e-75
Family Protein kinases, catalytic subunit 0.00000637
Further Details:      
 
Domain Number 2 Region: 715-902
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.98e-50
Family Nucleotide and nucleoside kinases 0.0000000389
Further Details:      
 
Domain Number 3 Region: 587-705
Classification Level Classification E-value
Superfamily SH3-domain 3.54e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 454-554
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 324-373
Classification Level Classification E-value
Superfamily L27 domain 2.35e-19
Family L27 domain 0.0000788
Further Details:      
 
Domain Number 6 Region: 383-434
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000447
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006597   Gene: ENSTGUG00000006375   Transcript: ENSTGUT00000006663
Sequence length 906
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:6414404:6558869:1 gene:ENSTGUG00000006375 transcript:ENSTGUT00000006663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLKREASICHMLKHPHIVELLE
TYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASHYMRQILEALRYCHDNNIIH
RDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKP
VDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLML
DPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNS
FYGDPPEELPDFSEDPTSSGISIERAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHL
HTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMAL
LQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEP
MGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMR
GSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQ
FEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEW
RVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRK
TLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDI
SNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAP
TITPGINEDESLQRLQKESEILQRTYAHYFDLTIINNEIDETIRHLEEAIELVCTASQWV
PVSWVY
Download sequence
Identical sequences H0Z7P7
ENSTGUP00000006597 ENSTGUP00000006597 59729.ENSTGUP00000006597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]