SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006598 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006598
Domain Number 1 Region: 4-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.77e-72
Family Eukaryotic proteases 0.000000741
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006598   Gene: ENSTGUG00000006409   Transcript: ENSTGUT00000006664
Sequence length 261
Comment pep:novel chromosome:taeGut3.2.4:11:5895726:5899361:1 gene:ENSTGUG00000006409 transcript:ENSTGUT00000006664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLWVLSCLALVGFAHCGVPAIPPVVRGYNRIVNGEAVVPGSWPWQVSLQRNYGFHFCG
GLISENWVVHRCPLRVRKTDSVVVGAYDQDAPGPDQQELKIEKVFKNPRFNMLTIHDDIT
LIKLATPAQLSDRVSPVCLPAATDEFPGGMTCVTTGWGLTDSSASDTPAVLQQAAVPLLT
NAQCKEFWGFRIRDVMVCAGADGASSCMGDSGGPLVCQRDGAWNLVGIVSWGSNTCDTKT
PGVYARVTKLRGWIDSILEAN
Download sequence
Identical sequences H0Z7P8
ENSTGUP00000006598 59729.ENSTGUP00000006598 ENSTGUP00000006598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]