SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006614 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006614
Domain Number 1 Region: 257-363
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.22e-41
Family Transforming growth factor (TGF)-beta 0.00000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006614   Gene: ENSTGUG00000006434   Transcript: ENSTGUT00000006680
Sequence length 363
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:25960742:25964692:-1 gene:ENSTGUG00000006434 transcript:ENSTGUT00000006680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGRPASARAAPRGLLSEFELRLHMFGLKRRPSPGKDVVIPPYMLDLYRLHAGQQLGQPAA
LGFPLERAASRANTVRSFHHEEVLEELPEMSGKTARRFFFNLTSIPHEESITSAELQIFR
KQVHGAFENNSSYHHRINIYEIIKPATATSKDPVTRLLDTRLVHHNASKWESFDVTPAVL
RWIAHGQPNHGFVVEVVHLDKENSASKRHVRRISRSLHQDEDSWSQLRPLLVTFGHDGKG
HPLHKREKRQAKHKQRKRHKYSCKRHPLYVDFNDVGWNDWIVAPPGYSAFYCHGECPFPL
ADHLNSTNHAIVQTLVNSVNSKIPKACCVPTELSAISMLYLDENEKVVLKNYQDMVVEGC
GCR
Download sequence
Identical sequences H0Z7R4
ENSTGUP00000006614 ENSTGUP00000006614 59729.ENSTGUP00000006614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]