SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006616 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006616
Domain Number 1 Region: 161-235
Classification Level Classification E-value
Superfamily UBA-like 7.51e-18
Family UBA domain 0.0024
Further Details:      
 
Domain Number 2 Region: 13-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000871
Family Ubiquitin-related 0.01
Further Details:      
 
Domain Number 3 Region: 275-326
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000167
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006616   Gene: ENSTGUG00000006430   Transcript: ENSTGUT00000006682
Sequence length 401
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:9365895:9378327:1 gene:ENSTGUG00000006430 transcript:ENSTGUT00000006682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XIFAGKVLRLKSTMEGAEWLEEVAEDTTVEKLKERCLKHCLPGSLEDPKTVTHHKLIHAT
SEKVLTDTKTVLEENIQDRDVLLLVKKRAPTLLPKMSDVVAEEKRKQEQKAPDKDAILKA
TANLPARSVDRSVSHHNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFKKANAMLDED
EEDRVDEIALRQLTEMGFPESRAVKALRLNHMSVTQAMEWLIEHADDPSVDAPLPGSAPA
EAPAEGAASSAEAAAGPSSEEGGEEAKDELTEIFKKIRRKREFRPDPRAVIALMEMGFDE
KEVVDALRVNNNQQNAACEWLLGDRKPSPEDLDKGIDTNSPLFQAILENPVVQLGLTNPK
TLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Download sequence
Identical sequences H0Z7R6
59729.ENSTGUP00000006616 ENSTGUP00000006616 ENSTGUP00000006616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]