SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006643 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006643
Domain Number 1 Region: 568-656
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-20
Family Third domain of FERM 0.0051
Further Details:      
 
Domain Number 2 Region: 381-474
Classification Level Classification E-value
Superfamily PH domain-like 1.67e-17
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 3 Region: 271-327
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000484
Family Second domain of FERM 0.012
Further Details:      
 
Domain Number 4 Region: 522-567
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000249
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006643
Domain Number - Region: 26-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0653
Family Ubiquitin-related 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006643   Gene: ENSTGUG00000006448   Transcript: ENSTGUT00000006709
Sequence length 679
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:26142623:26158658:1 gene:ENSTGUG00000006448 transcript:ENSTGUT00000006709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSTEYGSHTWDLLLTVDHQHEGVEKEIPLQVTGDLHVGGLMLKLVEKIKIAQDWSDYA
FWWEQKKCWLLKTHWTLDKCGVQADAKLIFTTQHKMLRLRLPNMKTVRLKVSFSSMVFRA
VSDICKMLNIRRSEELSLLKQSEGTLKKKKKKDKNSKEPATEDILNLCNSPVSSGLPANP
GLYSKTMTPIYDPVSGSPASSTITWFSDGSSAEQNCSILALSHPTCSPEMLAEMYQPRTL
ADKAKLNAGWLDSSRSLMEQGVLEEDQLLLRFKYYTFFDLNPKYDAVRINQIYEQARWAI
LLEEIDCTEEEMLIFAALQALYHVSKLSLSSETQDSTCESEVDEVEAALSNLEVTLEGGN
KSNILEDITDIPKLADNLKLVRPKKLALKAIKTYWFVFRDTSISYFKNKESAQGEPIEKL
NLKGCEVVPDVNVAAKKFGIKLLIPVADGMNEVYLRCDNEDQYARWMAACVLASKGRTMA
DSSYQPEVQKILSFLQMKNWTMCSQAASEPENVDMKPECFVSPRYTKKFKSKQLTARILE
AHQNVSQMSLVEAKLRFIQAWQSLPEFGLSYYIVRFKGSKKDDVLGVSYNRLIRIDLATG
DPITTWRFSNMKQWNVNWEIRQVAIEFDQNVSIAFTCLSADCKIIHEYIGGYIFLSTRSK
DHNETLDEELFHKLTGGQE
Download sequence
Identical sequences H0Z7U3
59729.ENSTGUP00000006643 ENSTGUP00000006643 ENSTGUP00000006643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]