SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006693 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006693
Domain Number 1 Region: 10-301
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-57
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006693
Domain Number - Region: 305-359
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000225
Family Ubiquitin-related 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006693   Gene: ENSTGUG00000006485   Transcript: ENSTGUT00000006759
Sequence length 732
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:32965546:32987173:1 gene:ENSTGUG00000006485 transcript:ENSTGUT00000006759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTSNYLWLLSDILGQGATANVFRGRQKKTGDLYAVKVFNSISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLVMEFCPCGSLYTVLEEPSNAFGLPESEFLIVLRDVV
AGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKEHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITG
KPSGAISGIQKAENGPIEWSWEMPVSCSLSKGLQVLLTPVLANILEADQEKCWGFDQFFA
ETSDILHRIIIHIFSLQQMTLHKVYIHNYNTAAIFHELVYKQTKIPSQNQELIYEGRRLI
LEPGRLAQHFPRTTEENPIFVVSREAVNIVGLIYEEVLLPKVHQRYDLDGDASMAKAVTG
IVCYACRVASSLLLYQELMRKGIRWLIEIIKDDYNEIVHKKAEIVIRLDFCSRNIEKAEK
IYENLMQINLEASEVDEISEIHTKLLRLSSSQGTIETSLQDIKTKLSPGGLLTDTWANQE
GMHPKDRNPERLQALLSSITDIYYQFKKDKAERRLPYNEEQIHKFDKQKLYLHATKAIAL
FKDECVSKYDAFLDKAEDWTRQAIDFFNIWKQLLALTNQCFGIEEEVSKYQDYINELQDA
LPQKMFAASNGMKHTMNTVYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGAL
TMDGGLRNVDCM
Download sequence
Identical sequences H0Z7Z2
ENSTGUP00000006693 59729.ENSTGUP00000006693 ENSTGUP00000006693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]