SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006704 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006704
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily L domain-like 7.94e-38
Family Internalin LRR domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006704   Gene: ENSTGUG00000006528   Transcript: ENSTGUT00000006770
Sequence length 233
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:6737394:6738092:1 gene:ENSTGUG00000006528 transcript:ENSTGUT00000006770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVPAELWAQQGLRKLYLSDAGLREVPDELAELQHLRTLALDGNELMEVPEAVCDLPHLAH
LYLGRNGLQGLPPSFAQLQSLRCLWIEGNFLAHFPRALLQLPELRSLQLGDNRLCRLPAA
LPRMAGLRGLWLYGNRFQEFPPVLLRMDHIRVLDLDRNRIASFPDLTGLAALRLLSYDHN
PVRQPPRVGDEVQLVGDGAQEYMEARQERLQSLQRQEEEEEEGTEAAPVSPED
Download sequence
Identical sequences H0Z803
ENSTGUP00000006704 ENSTGUP00000006704 59729.ENSTGUP00000006704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]