SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006709 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000006709
Domain Number - Region: 368-415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00167
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 802-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.01
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 324-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 276-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0387
Family Laminin-type module 0.072
Further Details:      
 
Domain Number - Region: 542-587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0544
Family Laminin-type module 0.068
Further Details:      
 
Domain Number - Region: 716-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0718
Family Laminin-type module 0.042
Further Details:      
 
Domain Number - Region: 755-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 148-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0837
Family Laminin-type module 0.028
Further Details:      
 
Domain Number - Region: 499-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0858
Family Laminin-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006709   Gene: ENSTGUG00000006496   Transcript: ENSTGUT00000006775
Sequence length 1120
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:69064788:69127723:1 gene:ENSTGUG00000006496 transcript:ENSTGUT00000006775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLHFNSLFGFPVILLYHWMGSTVSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSC
TDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESREMCVPHCADKCVHGRCIA
PNTCQCEPGWGGPNCSSACDSEHWGPHCSSRCQCKNGALCNPITGACHCSAGFKGWRCEE
RCDPGSYGNDCHQKCQCQNKATCDHVTGECRCPPGYTGAFCEDLCPPGKHGPQCEERCPC
QNGGVCHHITGECSCPPGWMGMVCGQPCPEGRYGKNCSQECQCHNGGTCDSATGHCHCSP
GYTGERCQDECPVGSYGLLCAETCKCVNGGKCYHISGACLCEPGYTGQHCETRLCPEGIY
GLKCDKKCPCHMPNTWSCHPMSGECSCKPGWSGLYCNETCSPGFYGESCQQICSCQNGAD
CDSVTGKCTCAPGFKGASCGTPCLPGTYGVNCSSVCSCKNGATCSPVDGSCACKVGWHGV
DCSINCPSGTWGLGCNLTCQCLNGGACNALDGTCTCAPGWRGEKCELPCQDGTYGLDCAE
RCDCSHADGCHPTTGYCRCLPGWSGIHCDSVCAEGQWGPNCSLPCYCKNGASCSPDDGIC
ECAPGYRGTTCQRICSPGFYGHRCSQTCPQCVHSSGPCHHITGLCDCLPGFTGALCNEVC
PSGRFGKNCAGICTCTNNGTCNPIDRSCQCYPGWIGSDCSQPCPPSHWGPNCIHTCNCHN
GAFCSAYDGECKCTPGWTGLYCTQRCPLGFFGKDCALICQCQNGADCDHISGQCTCRTGF
MGRHCEHKCPQGTYGYGCRQICDCLNNSTCDHITGTCYCSPGWKGARCDQAGVIIVGNLN
SLSRTSTALPTDSYQIGAIAGIIILVLVVLFLLVLFIIYRQKQKGKETHMPTVTYTPAMR
VINADYTISETIPHTNGGNVNSHYFSNPSYHTLTQCSSPPHVTNMERLTLAKAKTSQLFV
NLKNMEPGKRSAVMDYTGTLPADWKHGGYLNELGAFGLDRGYVGKSLKDLVKNSDYNLSN
CSLSSSENPYATIKDPPALVPKSSECGYVEMKSPARRDSPYAEIAGSATASKNVYEVEPT
VSVVQGAFSSGGGRLGQDPYDLPKNSHIPCHYDLLPVRES
Download sequence
Identical sequences H0Z808
59729.ENSTGUP00000006709 ENSTGUP00000006709 ENSTGUP00000006709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]