SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006710 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006710
Domain Number 1 Region: 1011-1348
Classification Level Classification E-value
Superfamily NHL repeat 2.88e-26
Family NHL repeat 0.0012
Further Details:      
 
Domain Number 2 Region: 1247-1495
Classification Level Classification E-value
Superfamily NHL repeat 0.000000000012
Family NHL repeat 0.016
Further Details:      
 
Domain Number 3 Region: 706-781
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000334
Family Pre-dockerin domain 0.073
Further Details:      
 
Domain Number 4 Region: 448-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family EGF-type module 0.038
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006710
Domain Number - Region: 545-570
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000293
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 515-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 381-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00184
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 582-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0026
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 416-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00343
Family Integrin beta EGF-like domains 0.049
Further Details:      
 
Domain Number - Region: 351-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 2068-2196
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0392
Family SGL-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006710   Gene: ENSTGUG00000006481   Transcript: ENSTGUT00000006776
Sequence length 2545
Comment pep:known chromosome:taeGut3.2.4:4:37851968:37986811:1 gene:ENSTGUG00000006481 transcript:ENSTGUT00000006776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPPNNQGQSTLQPLPPSHKQHSAQHHPSITSLNRNSLTNRRNQSPAPPAALPAELQTTP
ESVQLQDSWVLGSNAPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSPPTRPLPRNT
LSRSAFKFKKSSKYCSWKCTALCAVGVSVLLAILLSYFIAMHLFGLNWQLQQTENDTFEN
GKVNSDTVPTHPVTVPAGDSGKLGGFAQENNTIDSGELDIGRRAIQEVPPGIFWRSQLFI
DQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIAREQRNLLESERAGR
QARSVSLHEAGFIQYLDSGIWHLAFYNDGKNAEQVSFNTIIIESVVECPRNCHGNGECVS
GSCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCYSGWKGTECDVPTSQCIDPQCGGR
GICIMGSCACNSGYKGENCEEADCMDPACSSHGVCIHGECHCNPGWGGSNCEILKTMCSD
QCSGHGTYLQESGSCTCDPNWTGPDCSNEICSADCGTHGVCVGGTCRCEEGWTGAACNQR
ACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKEGCPGLCNSNGRCTLDQNGWH
CVCQPGWRGAGCDVAMETLCTDSKDNEGDGLADCMDPDCCLQSSCQNQPYCRGLPDPQDI
ISQSQQSPSQQAAKAFYDRISFLIGAESTHVIPGESPFNKSLASVIRGQVLTADGTPLIG
VNVSFLHYPDYGYTITRQDGMFDLVANGGASLTLVFERSPFLTQYHTVWIPWNVFYVMDT
LVMKKEENDIPSCDLSGFVRPNPVIVSSPLSTFFRISPEDSPIIPETQVLHEETTIPGTD
LKLSYLSSRAAGYKSVLKITMTQSVIPFNLMKVHLMVAVVGRLFQKWFPASPNLAYTFIW
DKTDAYNQRVYGLSEAVVSVGYEYESCLDLTLWEKRTAILQGYELDASNMGGWTLDKHHV
LDVQNGILYKGNGENQFISQQPPVVSSIMGNGRRRSISCPSCNGQADGNKLLAPVALACG
IDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRHSNNPAHRYYLATDPVTGDLYVSDTN
TRRIYRPKSLTGAKDLTKNVEVIGGTGEQCLPFDEARCGDGGKAVEATLMSPKGIAIDKN
GLIYFVDGTMIRKVDQNGIISTLLGSNDLTSARPLTCDTSMHISQVRLEWPTDLAINPMD
NSIYVLDNNVVLQITENRQVRIAAGRPMHCQVPGVEYTVGKHAVQTTLESATAIAVSYSG
VLYITETDEKKINRIRQVTTDGEISLVAGIPSECDCKNDVNCDCYQNGDGYAKDAKLNAP
SSLAVSPDGTLYIADLGNIRIRAVSKNKPLMNSMNFYEVASPTDQELYIFDVNGTHQYTV
SLVTGDYLYNFSYSNDNDITAVTDSNGNTLRIRRDPNRMPVRVVSPDNQVIWLTIGTNGC
LKSMTAQGQELVLFTYHGNSGLLATKSDETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGE
MERAITVDIKSSSREEDVSITSNLSSIDSFYTMVQDQLRNSYQIGYDGSLRILYASGLDS
HYQTEPHVLAGTANPTMAKRNMTLPGENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNL
LSVDFDRTTKTEKIYDDHRKFLLRIAYDTSGHPTLWLPSSKLMAVNVTYSSTGQIGSIQR
GTTSEKIEYDGQGRIVSRVFADGKTWSYTYLEKSMVLLLHSQRQYIFEYDLLDRLSAVTM
PSVARHTMQTIRSIGYYRNIYNPPESNASVIMDYNEEGQLLQTAFLGTSRRVLFKYRRQT
KLSEILYDSTRVSFTYDETAGVLKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVN
ARFDYSYDNSFRVTSMQGVINETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAV
MTYTKHFDAHGRIKEIQYEIFRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDV
DGQLQTVYLNEKIMWRYNYDLNGNLHLLNPSSSARLTPLRYDLRDRITRLGDVQYRLDED
GFLRQRGTEIFEYSSKGLLTRVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLT
YPTRITHVYNHSSSEITSLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLK
QIQYTAYGEIYFDSNLDFQLVIGFHGGLYDPLTKLVHFGERDYDILAGRWTTPDIEIWKR
IGKDPAPFNLYMFRNNNPASKIHDVKGYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEP
SYELVKSQQWEDIPPISGVQQQVARQAKAFLSLGKMAEVQVSRRKSSGEKSWLWFATVKS
LIGKGVMLAVNQGKVQTNVLNIANEDCIKVAAVLNNAYYLENLHFTVEGKDTHYFIKTTS
PESDLGTLRLTSGRKALENGINVTVSQSTTVVNGRTRRFADVEMQYGALALHVRYGMTLD
EEKARILEQARQRALSSAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLS
VEQYPELADSANNIQFLRQSEIGKR
Download sequence
Identical sequences H0Z809
ENSTGUP00000006710 59729.ENSTGUP00000006710 ENSTGUP00000006710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]