SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006756 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006756
Domain Number 1 Region: 194-333
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.96e-45
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000402
Further Details:      
 
Domain Number 2 Region: 2-191
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 2.73e-45
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.0000338
Further Details:      
 
Domain Number 3 Region: 394-497
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-26
Family Ubiquitin-related 0.001
Further Details:      
 
Domain Number 4 Region: 332-419
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000463
Family Ubiquitin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006756   Gene: ENSTGUG00000006574   Transcript: ENSTGUT00000006824
Sequence length 500
Comment pep:novel chromosome:taeGut3.2.4:12:6800615:6803063:-1 gene:ENSTGUG00000006574 transcript:ENSTGUT00000006824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRTVTTEKLDGWIASSLQPSKAFSDQVKEIVQKICQLLKGNGFEDNICVEKTVKGGSAGK
GTALKNSSDADVVLFLSCLPSYQEQKTRKAILDLLMMRLKVCKESLQFPVSIGEPRYKGP
EGMPHSLRLTLSSRETRESIDVDILPAYDALGQVTRDAPPNAEAYVRLLHACSHPGEFSL
CFTKLQKMFVKRCPAKLKNLLRLVKFWYKEMLNPQCPSADLPPKYALELLTIYAWEEATG
SASSFDMAQGFRTVLELLCRYREICIYWEKYYSLQHREIGAHVKGLLRRPRPVILDPADP
TGILGQDKKWDVVAQAAASYCNSLPFLADVQSWEVEPARRVSIEVLQLSGTKMTERVSPY
TTIRQLKQMIQKNWGISPYTQRLAQQELGRNNIILKDCDTLAMHGIFYNTTLVLLQTEPQ
EMQVFVKDDKNRSTTYTVLPTDTVRQLKEQIQARQGPSPSEQRLTYGSRELEDQFTLADY
DVKPMSTIYMLLRLRGGVGP
Download sequence
Identical sequences H0Z853
59729.ENSTGUP00000006756 ENSTGUP00000006756 ENSTGUP00000006756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]