SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006760 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000006760
Domain Number - Region: 216-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000364
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 183-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000559
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 279-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000754
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 247-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 312-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0286
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 88-162
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0706
Family NadC C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006760   Gene: ENSTGUG00000006579   Transcript: ENSTGUT00000006828
Sequence length 381
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:33221713:33265703:-1 gene:ENSTGUG00000006579 transcript:ENSTGUT00000006828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCGSMAPAGRLCCAALLCGALSLCSLRAAPRQPDTLYLWIDAQQARVLIGKCFEEDILIV
SEGKMAPFTHDFRKAQQRMPAIPVGIHAMNFTWQATGRAEYYYEFLSLHSLDKGIMADPT
INIPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIIMNSEGNIILQTPQNAIFFKTCQ
QAECPGGCRNGGVCNERQVCECPDGFYGPHCEKALCVPRCMNGGLCITPGLCICPPGFYG
INCDKANCTTTCFNGGTCFYLGKCICPSGYEGDQCEISKCHQPCRNGGKCTGKNKCKCSK
GYQGDLCSKPVCEPNCGLYGTCVEPNKCQCKEGWHGRHCNKRYGASGLSALRPAGSKNRQ
HTPSPKRAEEKHVPPESNYIW
Download sequence
Identical sequences H0Z857
ENSTGUP00000006760 ENSTGUP00000006760 59729.ENSTGUP00000006760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]