SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006782 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006782
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 1.78e-83
Family Integrin A (or I) domain 0.000000075
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-24
Family Integrin domains 0.00038
Further Details:      
 
Domain Number 3 Region: 622-703
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000111
Family Integrin beta tail domain 0.0015
Further Details:      
 
Domain Number 4 Region: 20-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000282
Family Plexin repeat 0.0011
Further Details:      
 
Domain Number 5 Region: 579-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Integrin beta EGF-like domains 0.0024
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Integrin beta EGF-like domains 0.011
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000068
Family Integrin domains 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006782
Domain Number - Region: 507-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006782   Gene: ENSTGUG00000006539   Transcript: ENSTGUT00000006850
Sequence length 789
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:11122840:11150008:-1 gene:ENSTGUG00000006539 transcript:ENSTGUT00000006850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLCFLFLLRNNYVQGTCSQESTVTCEDCLLSGPHCAWCLQENYTDSSGIHGRCD
TLENLLSKGCQLNFIEFPISEVEIHRNDPLTASSQKNGYDVTQISPQKLTLRLRPGHAET
IQIKVRQTEDYPIDLYYLMDLSASMDDDLNTIKELGSTLSKEMSKLTSNFRLGFGSFVEK
PVSPFIKTTAAEINNPCRSVPYECLPTFGYKNVLPLTNDAEKFNEIVKGQRISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGNCHLDHNNE
YSMSTVQEYPTIGQLIDKLVQNNVLLIFAVTNEQVHLYENYAKLIPGATVGRLQKDSGNI
LQLIIAAYQELRSEVELEILGETEGLNLSFTAICNNGTFFPHQRKCSHVKVGDTVSFNVT
VSLSSCDKTRRLIKIKPVGLSDMLEMEIHPLCSCNCQAKAEKKSPKCSQGKGSLECGVCV
CSPGYVGPRCECHESSLGASSCRGPAEHSSCSGRGDCYCGQCLCHPSPYGKVYGPRCECN
DFSCVRHRGLQCAGNGDCDCGECRCYSGWTGEYCNCTTDTSTCIAEDGTLCSGRGECICG
TCACTHPGALGQTCEKCPLCGDPCSSRWSCVECHLASDDKSLGDCSEKCKLVDATVSVAK
DYSEDKSISCSLQGENECITTFLLSVDEQGRTVIHSIERKDCAQHPNIPMIVVGVTLAIL
LIGIVLLCIWKLLVSLQDRKEVAKFEAEKSKVKWQTETNPLYRGSTTTFKNVTYKNQDMH
KRPMAADFY
Download sequence
Identical sequences H0Z879
XP_002193421.1.42559 ENSTGUP00000006782 59729.ENSTGUP00000006782 ENSTGUP00000006782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]