SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006850 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006850
Domain Number 1 Region: 12-100,147-403,492-551
Classification Level Classification E-value
Superfamily MFS general substrate transporter 9.42e-31
Family LacY-like proton/sugar symporter 0.056
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006850
Domain Number - Region: 417-454
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00104
Family Ovomucoid domain III-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006850   Gene: ENSTGUG00000006636   Transcript: ENSTGUT00000006919
Sequence length 616
Comment pep:novel chromosome:taeGut3.2.4:9:5025687:5049160:-1 gene:ENSTGUG00000006636 transcript:ENSTGUT00000006919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSRSFFCNIKVFVLCHGLLQLSQLLYSANFKSSLTTIEKRFGLSSLSSGFISSLHEIGNV
VLIIFVSYFGSRVHRPRVIGVGGLLLALGAFLVTLPHFLSGPYEYTALSTGNKSQGQVEL
CYAESRFVCPNTTRDPEKEASSMWAMMVIAQLLAGIGTVPIQPFGISYVDDFADSNNSPL
YVAILFAIAVFGPAFGYLLGSVVLRLFVDIGRVDTDTVDLTPSDQRWIGAWWLGLLISSG
CLVLTSIPYFFFPRYMLKGEERNTEAGMLRKMETGAAQETSLLEFIKRFPKIFLRLLLNP
LFILLVLAQCSFSSVIAGLATFLNKFLEKQYGASPSQANFLIGAVNLPAAALGMLLGGII
MKRFSFSLRAIPRFAVVVLVFSILICLPIFFMGCSTGHIEGIYHPSTPNSQQQVKARVGC
QCSKQIFHPVCRKNTTEYISPCFAGCTNSTTNPSNPRQTIYHNCSLNGNELFSTYTGSCP
VSCSHMLLPAIFLISFAALVACLSHNPLYMMVLRVVNQDEKSFAIGVQFLLMRLLAWLPA
PAMFGALIDSSCIYWQQQQCTPGRFCAYYNNDFLRNRYLGLQVGYKVVGTVLLALISWKV
KRSKEYNVQEKAAGLV
Download sequence
Identical sequences H0Z8E7
ENSTGUP00000006850 59729.ENSTGUP00000006850 ENSTGUP00000006850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]