SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006877 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006877
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000957
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006877   Gene: ENSTGUG00000006694   Transcript: ENSTGUT00000006946
Sequence length 248
Comment pep:novel chromosome:taeGut3.2.4:3:26426080:26429183:-1 gene:ENSTGUG00000006694 transcript:ENSTGUT00000006946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPDSGDNGRLLYSLVRGQTSEFDINENTGQIFTVSVAGKAGTFYLEVQAADQGTRRLTAW
TTVNVTVDSSSSSNIVMLVLSQKINAVERKRVEVQRVLEDKLGWNVYVLNIYSKESDRNS
RSSTDETQVDIIAFDEAHQEVPAEDVKRKLREQQADLELGLEEVFSASVSAAVGEAAAAP
ASPELVAAIVLGVLLAGTFVAFLAYVLLDLKRKRYIKKVEIMEGIDNPWADDKNGNLKSL
EKPEHMNN
Download sequence
Identical sequences H0Z8H4
ENSTGUP00000006877 ENSTGUP00000006877 59729.ENSTGUP00000006877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]