SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006880 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000006880
Domain Number - Region: 1-48
Classification Level Classification E-value
Superfamily Cadherin-like 0.00392
Family Cadherin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006880   Gene: ENSTGUG00000006698   Transcript: ENSTGUT00000006949
Sequence length 66
Comment pep:novel chromosome:taeGut3.2.4:3:26430537:26431214:-1 gene:ENSTGUG00000006698 transcript:ENSTGUT00000006949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDKGSPPLNGTAVVTLSVFDNRPFVPRLNKSEISISVLENTGVDYLIYDFAVVETSGK
PIDYTV
Download sequence
Identical sequences H0Z8H7
ENSTGUP00000006880 ENSTGUP00000006880 59729.ENSTGUP00000006880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]