SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006888 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006888
Domain Number 1 Region: 462-593
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-33
Family Cadherin 0.0032
Further Details:      
 
Domain Number 2 Region: 146-254
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 566-692
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 4 Region: 357-466
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 255-369
Classification Level Classification E-value
Superfamily Cadherin-like 3.66e-19
Family Cadherin 0.0033
Further Details:      
 
Domain Number 6 Region: 39-139
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 7 Region: 3-51
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000002
Family Cadherin 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006888   Gene: ENSTGUG00000006703   Transcript: ENSTGUT00000006957
Sequence length 692
Comment pep:novel chromosome:taeGut3.2.4:3:26439268:26448510:-1 gene:ENSTGUG00000006703 transcript:ENSTGUT00000006957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKGVISTKKKLDYESQKNYTLNISLSDGSTADYAMVFIRVTDVNDNSPVFGTTSTTIAI
AENMPVGTNVTGVSATDMDEGFNGLVVYSLKGGEGTMDIDSSGFIFLQKVLDREXXXXXX
XXXXXXEQGQPMRSTALNLTIIIDDVNDNPPVFSSSRYEVKVPEDQELGSALLTLAATDL
DAGANAFVMYRITDQRPQTSSPVFLVNSSTGQFSLSQQLDYETINKFEVQVEASDGGQPS
LSTETLVVVCVEDVNDNPPEFSQAAYDVFVFENHLTGSPVYTFSVADRDEVGTAENFVLL
SLEPAETFPTQLQDGTILVTGSVDRESKDKYELLLVASDNGVPLRQATPQNFTHISIQVL
DVNDNPPQFTRAQYSASVPVAAAKEGEFVLAVSATDLDLGNNAVISYSFMNHSDDFHINN
GTGEISLSNNLDHITADTVVTLTVVATDHGVPQLTSTGKVTVRVEDINDNPPVFSAWIQT
HLSAPENAAGLDLGTFSATDLDAGDNALISYSLQDDFAETFHINSSTGKLMTKKPLDREV
MDSYELKIIATDSGKPPQSASSVLSITVEDVNDNPPVFPQKSYSVTVRENEPPHVILSAV
ATDADIGYNAIIHYTITGETISFHVGEFSGDIATLQPLDYESQSQYMLILKAFNPGEPHL
QDTANITECGDSFSVTVEDVNEEGPVFDQSSY
Download sequence
Identical sequences H0Z8I5
59729.ENSTGUP00000006888 ENSTGUP00000006888 ENSTGUP00000006888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]