SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006927 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006927
Domain Number 1 Region: 132-385
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-79
Family Eukaryotic proteases 0.00000519
Further Details:      
 
Domain Number 2 Region: 21-126
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-25
Family Kringle modules 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006927   Gene: ENSTGUG00000006730   Transcript: ENSTGUT00000006996
Sequence length 385
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:14390893:14395866:-1 gene:ENSTGUG00000006730 transcript:ENSTGUT00000006996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TECLCLNGGRCISYYLFSGITRCICPDGYTGIHCELDTDSTCYTENGEDYRGMATEDKCL
PWNLPSLIRRGHYHAYSENALQLGLGKHSYCRNPNGRSRPWCYTKRGSAIQETPCNIEKC
EHLNKIFPFAGPTCGQRSISKNFKIVGGRQAEVESQPWIAGIFQTVRGRDQFLCGGSLID
PCWVLTAAHCFHTPPINKSIYKVFLGKSILNVTDDKEQVFIVDEIISHPDFTDDTGGNEN
DIALVRIKTTSGQCAVESKYVRTVCLPERNLYLKENTHCEIAGYGKQDFYDIFYAQRLMS
ATVNLISQRKCKYEYYDNIRVTDNMVCAGDPAWQIDACKGDSGGPMVCEHNGRMMVYGIV
SWGDGCAKENKPGVYTRVTQYLNWI
Download sequence
Identical sequences H0Z8M4
ENSTGUP00000006927 ENSTGUP00000006927 59729.ENSTGUP00000006927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]