SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006930 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006930
Domain Number 1 Region: 847-1146
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000011
Family Rhodopsin-like 0.039
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006930
Domain Number - Region: 468-527
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000497
Family Hormone receptor domain 0.0029
Further Details:      
 
Domain Number - Region: 190-311,344-396
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00196
Family YVTN repeat 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006930   Gene: ENSTGUG00000006679   Transcript: ENSTGUT00000006999
Sequence length 1488
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:14047115:14171612:-1 gene:ENSTGUG00000006679 transcript:ENSTGUT00000006999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSGCRMQSFWFLLIISFLQCTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTECFLPDAYKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYSNSIFFVCPGTLKAIVDSPYLYEAEQKAGAWCKDPLQAADKIYFMPWT
PYRTDTLIEYASLEDFQNGRQQTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRT
RIKSGEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTL
RFEATWETTYDKRAASNAFMICGVLYVVRSVYQDNESETGRNAIDYIYNTRLSRGEHVDI
PFPNQYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELYKT
TVSTTSTTSQRGPISTTSAGGTKEGSRGPKPPPPPISTTKIPPVTSFFPLPERFCEPTEA
RGISWPQTQRGMMVERPCPKGTRGTASYLCVVLTGMWNPKGPDLSNCTSHWVNQLAQKIR
SGENAASLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELRPSEKDSAGRSYNK
LQKREKTCRAYLKAVVDTVDNLLRPEALESWKDMNSSEQAHAATMLLDTLEEGAFVLADN
LVEPSRVSMPTENIVLDVAVLSTEGQVQDLRFPQAGKGGNWIQLSARTMKQNSRNGLAKL
VFIIYKSLGRFLSTENATIKLGSDLAGQNSTIAVNSHVIAASINKESSRVYLTDPVHFTL
EHIDPDNYFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTHTTCACSHLTNFAILMARRE
IVYKDGVHELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEF
IFLIGIDKTEYKIACPVFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYV
AGYLFPATVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNLIFLVITLCK
MVKHSNTLKPDSSRLENINNYRVCDGYYNTDLPGYEDNKPFIKSWVLGAFALLCLLGLTW
SFGLLFINEGTVVMTYLFTVFNAFQGMFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTE
SPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGMTGNY
LLTNPLLRPHGTNNPYNTLLAETVVCNAPSAPVFNSPGHSLNNARDTSAMDTLPLNGNFN
NSYSLRNGDYNDSVQVVDCGLSLNDTAFEKMIISELVHNNLRGSSKNHNLERVLPAKAVI
GGSSSEDDAIVADASSLMHSDTPGLELHHKELEAPLIPQRTHSLLYQPQKKVKPEGTDSY
VSQLTAEADDHLQSPNRDSLYTSMPNLRDSPYPESSPDVEEDLSPSRRSENEDIYYKSMP
NLGAGHQLQMYYQISRGNSDGYIIPINKEGCIPEGDVREGQMQLVTSL
Download sequence
Identical sequences H0Z8M7
ENSTGUP00000006930 59729.ENSTGUP00000006930 ENSTGUP00000006930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]