SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006936 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006936
Domain Number 1 Region: 92-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 240-299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 38-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000297
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006936   Gene: ENSTGUG00000006739   Transcript: ENSTGUT00000007005
Sequence length 442
Comment pep:novel chromosome:taeGut3.2.4:1:7838726:7859276:1 gene:ENSTGUG00000006739 transcript:ENSTGUT00000007005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFFFSLISIVGSGYSPLEDDEDVYARSRYKETPWCSPIKVKHGYANCRTPQGEYYKNCVG
TRCDIRCQKGYELHGPHQLICQSSKRWSGKVLCKQKRCPTLSMPTNGGFKCLDGAYFGSR
CEYYCSPGYQLKGERVVTCLDSKAWSGRPAACVADTEPPRIQCPSVKEKSAEPNKLTARV
FWDTPEGRDTADGILTDVILKGLPPGSHFPEGDHKIQYTVYDRAENKGTCKFLVKVRVRR
CVKLNAPDNGYIKCSGDGNNYGATCEFSCIGGYELQGSPARVCQYNLGWSGVEPTCAPMN
INVNVRTAAALLDQFYEKRRLLIISTPTAANFFYRMQLGMLQPAQCGLDLRHVTVVELVG
VFPAQIGRIGVKLLPPSLALQLRLLLRIPHYNFNIVVMDKHGMDKERYPFPATPAELFAL
IDKFPLRKDEMKLQAEIGQSCP
Download sequence
Identical sequences H0Z8N3
ENSTGUP00000006936 ENSTGUP00000006936 59729.ENSTGUP00000006936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]