SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006940 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006940
Domain Number 1 Region: 86-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 233-292
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000347
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 52-101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000862
Family Complement control module/SCR domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006940   Gene: ENSTGUG00000006739   Transcript: ENSTGUT00000007009
Sequence length 434
Comment pep:novel chromosome:taeGut3.2.4:1:7838756:7859273:1 gene:ENSTGUG00000006739 transcript:ENSTGUT00000007009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGYSPLEDDEDVYARSRYKETPWCSPIKVKHGYANCRTPQGEYYKNVGIECVGTRCDIR
CQKGYELHGPHQLICQSSKRWSGKVLCKQKRCPTLSMPTNGGFKCLDGAYFGSRCEYYCS
PGYQLKGERVVTCLDSKAWSGRPAACVDTEPPRIQCPSVKEKSAEPNKLTARVFWDTPEG
RDTADGILTDVILKGLPPGSHFPEGDHKIQYTVYDRAENKGTCKFLVKVRVRRCVKLNAP
DNGYIKCSGDGNNYGATCEFSCIGGYELQGSPARVCQYNLGWSGVEPTCAPMNINVNVRT
AAALLDQFYEKRRLLIISTPTAANFFYRMQLGMLQPAQCGLDLRHVTVVELVGVFPAQIG
RIGVKLLPPSLALQLRLLLRIPHYNFNIVVMDKHGMDKERYPFPATPAELFALIDKFPLR
KDEMKLQAEIGQSC
Download sequence
Identical sequences H0Z8N7
ENSTGUP00000006940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]