SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006963 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006963
Domain Number 1 Region: 516-640
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.12e-19
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 2 Region: 1670-1741
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-18
Family TB module/8-cys domain 0.00037
Further Details:      
 
Domain Number 3 Region: 2033-2103
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-18
Family TB module/8-cys domain 0.0000915
Further Details:      
 
Domain Number 4 Region: 2111-2245
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-18
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 2318-2390
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.32e-18
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 6 Region: 1831-1956
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.16e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 7 Region: 432-559
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 8 Region: 1009-1138
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.41e-17
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 9 Region: 932-1002
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.46e-17
Family TB module/8-cys domain 0.0009
Further Details:      
 
Domain Number 10 Region: 635-708
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.96e-16
Family TB module/8-cys domain 0.00092
Further Details:      
 
Domain Number 11 Region: 694-836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 12 Region: 2429-2561
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 13 Region: 1301-1436
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.61e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 827-911
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.98e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 15 Region: 148-233
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.24e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 16 Region: 1510-1583
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.37e-16
Family TB module/8-cys domain 0.0000534
Further Details:      
 
Domain Number 17 Region: 1185-1307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000033
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 18 Region: 2204-2320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000989
Family Growth factor receptor domain 0.0094
Further Details:      
 
Domain Number 19 Region: 296-360
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000000000235
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 20 Region: 2558-2674
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 1589-1644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000265
Family EGF-type module 0.00063
Further Details:      
 
Domain Number 22 Region: 2389-2437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000127
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 23 Region: 1994-2047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000288
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 24 Region: 1467-1514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000144
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 25 Region: 1748-1803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000301
Family EGF-type module 0.0024
Further Details:      
 
Domain Number 26 Region: 1948-1990
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000479
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 27 Region: 1133-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000671
Family EGF-type module 0.007
Further Details:      
 
Domain Number 28 Region: 1430-1478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 29 Region: 253-294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 30 Region: 1791-1829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000081
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000006963
Domain Number - Region: 87-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0034
Family EGF-type module 0.012
Further Details:      
 
Domain Number - Region: 119-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00512
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006963   Gene: ENSTGUG00000006641   Transcript: ENSTGUT00000007032
Sequence length 2818
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:69438551:69557223:-1 gene:ENSTGUG00000006641 transcript:ENSTGUT00000007032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HREDGTGSAAGRVRRRGQQDALRGPNVCGSRFRSYCCPGWKTLSGGNQCIVPICRNSCGD
GFCSRPNMCTCANGQISPTCGARPAQQCSISCRNGGTCVDEQCQCQKGFSGAHCEQPVCE
SGCQNGGRCVGPNRCACIYGFTGPQCQRDYRTGPCFTQVSKQMCQGQLTGIVCTKSLCCA
TVGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGVCQGGNCINSVGSYEC
KCPVGHKQNEATQKCDDIDECSVIPGICEDGACSNTVGSYFCICPRGFVTSVDGSCTPDQ
RAGSCFSSSASGRCVQELPGRFTRRQCCCESGYCWASGSVPEVCPVRGSDDHRRLCVDGA
PARGGSRRGGAGGNGFHPRGNGNGFGPRGAGFIPIPGSNGFSPAVGAGVGAGGHSSTGSG
PIITGLILLRQTIDNCKHHPNLCLNGRCIPTPSSYRCECNMGYKQDANGDCIDVDECTSN
PCSNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECVQNGVLCKNGRCVNTEGSFQCIC
NAGFELTTNGKNCVDHDECAATNMCLNGMCINEDGSFKCICKPGFVLAPDGRFCTDIDEC
QTSGICMNGHCINTEGSFRCDCPPGLVVGVDGRVCVDTHVRSTCYGGIRKGLCVRPFPGA
VTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGIGITVDGRDINECALDPDICSNG
ICENLRGSYRCNCNSGYQPDPAGTNCVDVDECSMNGLLCDNGLCRNTPGSYSCSCPRGYL
FSPETDTCEDINECESSPCVNGACRNNLGSFHCECSSGSKLDPTGLICIDSLKGTCWLNI
RDSHCEVNINGATLKSECCATLGAAWGSPCERCELDTACSRGFARVKGVTCEDVNECEVF
PGVCPNGRCINSRGSFHCECPEGLTLDGTGRVCLDIRMEQCYLRWEEEECVQPVPGRLRM
DSCCCAVGAAWGSSSCQRCPVPSSQEHRDLCPRGSGFSNRGDVLTGRPFYKDINECKVFP
GMCMNGKCRNTIGSFKCRCNSGFTLDMEERNCTDIDECRISPDLCGSGTCVNTPGSFECE
CFDGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFRCDCPLGHELSPSQEECLDV
NECSLSDSLCRNGRCVNMVGTYQCFCDSGYQPTPDRQGCTGKYIDECMIMNGGCDTHCTN
SEGSYECSCSDGYALMPDVRTCADIDECENNPDICDGGQCSNIPGEYRCLCYDGFIVSTD
MKNCVDVNECDLNSNICMFGECENTKGSFICHCQAGYSVKKGTTGCTDVNECEIGAHNCD
MHASCVNVPGSFKCSCREGWVGNGIKCIDLDECANGTQQCSANAQCVNSPGSYHCACAEG
FTGDGFTCSDVDECAENVNLCENGQCLNAPGAFRCECEMGFTPASDSKSCQDTDECSFQN
ICVFGTCNNLPGMFRCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCP
PDFQLNPTGVGCVDNRVGSCYLKFGPRGDGGLSCNTEVGVGVTRSSCCCSLGKAWGNPCE
TCPPVNSTEYNTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPK
GYYLSEETRICEDIDECVAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHSCMDMRKSF
CYRSYNGTSCENELPFNVTKRMCCCTYNIGKAWNKPCEPCPAPGTVEFKSLCGNIPGFTF
DIHTGKAVDIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDN
LCQRNADCINSPGSYRCECAAGFKLSPNGACIDRNECLEIPNVCSHGLCVDMQGSYQCIC
HNGFKASQDQTMCMDVDECEQYPCGNGTCKNTVGSYNCLCYPGFELTRNNDCVDIDECSS
FGQVCRNGRCFNEIGSFKCLCNEGYELTLDGKNCVDTNECVALPGSCFPGTCQNLEGSFR
CICPPGYEVKSESCIDINECNEDPNICLFGSCTNTPGGFQCICPTGFVLSDNGRRCFDTR
QSFCFTNFENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKEEEVAFQDLCPYGHG
TIPGIDDTREDVNECLESPGICSSGHCINTDGSFRCECPMGYNLDFTGVHCIDTDECSIG
NPCGNGTCTNVVGSFECSCHEGFEPGPMMNCEDINECAQNPLLCAFRCINTYGFYECTCP
VGYELREDQKMCKDLDECAEGLHDCESRGMICKNLIGTFVCICPPGMTQRPDGEGCTDEN
ECRSKPGVCENGRCVNVVGSYRCECNEGFLSSPSGIECLDNRRGFCFAEVLQTMCQMASS
SQNLVTRSECCCDGGRGWGNQCRLCPLPGTSQYKKLCPHGSGYTTDGRDIDECKVLPNLC
RSGQCINTMGSFRCFCKAGYTTDITGTSCNDLDECSQSPRPCNFICKNSEGSYQCSCPRG
YVLQEDGKTCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSHPT
LCGSKGICQNTPGSFTCECQRGFSLDSTGLNCEDVDECDGNHRCQHGCQNILGGYRCGCP
QGFVQHYQWNQCVDENECSNPHMCGSASCYNTLGSYRCVCPSGFSYDQFSHACHDVNECS
SAKNPCSYGCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLTLDGDADKENALSPE
VCYECKINGYSKKDSRKKRSIREFPCSAERVSWGSLATDSPLKVRVAMSRLGGREPILEL
LPALGRRVRYAIARGNQHGTFQMLLRDGTSRLHAVRGRAARGLHALDITSTALPEEKE
Download sequence
Identical sequences H0Z8R0
59729.ENSTGUP00000006963 ENSTGUP00000006963 ENSTGUP00000006963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]