SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007038 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007038
Domain Number 1 Region: 152-229
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.32e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.6e-35
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-34
Family Ubiquitin-related 0.0000204
Further Details:      
 
Domain Number 4 Region: 236-288
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000253
Family Ubiquitin-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007038   Gene: ENSTGUG00000006823   Transcript: ENSTGUT00000007107
Sequence length 288
Comment pep:known chromosome:taeGut3.2.4:19:8088812:8089895:1 gene:ENSTGUG00000006823 transcript:ENSTGUT00000007107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGCETGPLCMTGKT
ITLEVELSDTIENVKAKIQDKEGIPPDSRLIFAGKQLEDGRTSDYNIQ
Download sequence
Identical sequences H0Z8Y5
59729.ENSTGUP00000007038 ENSTGUP00000007038 ENSTGUP00000007038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]