SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007051 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007051
Domain Number 1 Region: 318-478
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 157-317
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000349
Further Details:      
 
Domain Number 3 Region: 119-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000088
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 23-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000327
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 5 Region: 76-123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000677
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007051   Gene: ENSTGUG00000006826   Transcript: ENSTGUT00000007120
Sequence length 480
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:70483471:70749511:1 gene:ENSTGUG00000006826 transcript:ENSTGUT00000007120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRAVLAWLALCGSLAAPRPARADVCDSNPCQNGGICLSGLNDNFYSCECPQGFTDPNCS
SLVEVASIEEDPTSAGPCLPNPCHNGGICEISEAYRGDTFIGYVCKCPQGFNGIHCQHNV
NECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQQRCSGPLGIEGGIVSNQQITASSTH
RALFGLQKWYPYYARLNKKGLVNAWTAAENDRWPWIQINLQKKMRVTGVITQGAKRIGSP
EYVKSYKIAYSNDGKSWTMYKVKGTKEDMVFRGNVDNNTPYANSFTPPIKAQYVRLYPQV
CRRHCTLRMELLGCELTGCSEPLGMKSGHIQDFQITASSVFRTLNMDMFAWEPRKARLDK
QGKVNAWTSGHNDQSQWLQIDLLIPTKITGIITQGAKDFGHVQFVGSYKLAYSNDGEHWK
IYQDEKQKKDKVFQGNFDNDTHRKNVIEPPIYARHVRILPWSWYGRITLRSELLGCAAED
Download sequence
Identical sequences H0Z8Z8
XP_002189934.2.42559 XP_021407544.1.53032 ENSTGUP00000007051 59729.ENSTGUP00000007051 ENSTGUP00000007051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]