SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007065 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007065
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000691
Family Growth factor receptor domain 0.0028
Further Details:      
 
Domain Number 2 Region: 104-156
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000732
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007065   Gene: ENSTGUG00000006868   Transcript: ENSTGUT00000007134
Sequence length 170
Comment pep:known_by_projection chromosome:taeGut3.2.4:20:8314938:8315869:-1 gene:ENSTGUG00000006868 transcript:ENSTGUT00000007134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCVLCSEDNGCITCHHRLFLLIWRDGIRQYGMCVHTCPPGYFGVRGLEVNRCTKCRSPSC
ESCFNRDFCMMCKDNFTCTMASAFGCCPAGTAAQTGTRECQETCEPGPWSEWSACTHESR
TCGCRWGVETRVREVPEAAREEGTACPALLETRRCRMKKHCPGGEHRGQG
Download sequence
Identical sequences H0Z912
ENSTGUP00000007065 59729.ENSTGUP00000007065 ENSTGUP00000007065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]