SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007069 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007069
Domain Number 1 Region: 42-550
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 3.53e-188
Family Myeloperoxidase-like 0.000000000000114
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000255
Family EGF-type module 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007069   Gene: ENSTGUG00000006822   Transcript: ENSTGUT00000007138
Sequence length 568
Comment pep:known_by_projection chromosome:taeGut3.2.4:17:9996714:10001233:1 gene:ENSTGUG00000006822 transcript:ENSTGUT00000007138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNPCCYFPCQNQGVCVRVGLRGYECDCTRTGYYGVNCTSPELWTRLHNLLKPSPAFYHFI
LTHFKWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYISWEAYANVSYYTRVL
PPVPANCPTPMGTKGKLQLPDPQLLAERFLLRQKFEADPRGTNMMFAFFAQHFTHQFFKT
SGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEVYPPMVTEAPVH
MVYPSRVPQEQQLAMGQEVFGLLPGLCVYATLWLREHNRVCDLLKRDHPTWSDEQLFQTA
RLILIGETIKIVIEDYVQHLSGYYLSLKFDPELLFGSQFQYRNRIAVEFNQLYHWHGLMP
DSFIIQGQEYSYKQFLYNTSMLMDYGVEALVESFSKQVAGRIGGGQTINANVLHVAVGVI
QESRQLRLQPFNEYRKRFGMKPYKSFQELTGEEEKAAELEELYGDIDALEFYPGLLLEKP
QPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGATGFEIVKTASLEKLVCLNV
KKCPYVAFQVPAAAEHGSPRAAGSSTEL
Download sequence
Identical sequences H0Z916
ENSTGUP00000007069 ENSTGUP00000007069 59729.ENSTGUP00000007069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]