SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007077 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007077
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.28e-46
Family Phosducin 0.00000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007077   Gene: ENSTGUG00000006880   Transcript: ENSTGUT00000007146
Sequence length 218
Comment pep:known chromosome:taeGut3.2.4:17:10006222:10009132:-1 gene:ENSTGUG00000006880 transcript:ENSTGUT00000007146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLIKKLSMTCRSHLDDEADQQKQKELQEKINGKMTLQEYNMIHNDEDDEEFLQRYRKQ
RMEEMRQQLYSGQQFKQVFEITSGEAFLDTVDKEHKSTLIMIHIYEDDIPGTESLNGCMI
CLAAEYPTVKFCRVKSSLIGASTRFTNNALPALLVYKAGELIGNFVRITDQLGEDFFAVD
LEAFLQECGLLPEKDLLLLTSIHNPSACYSEDSDLEID
Download sequence
Identical sequences H0Z924
ENSTGUP00000007077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]