SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007088 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007088
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.65e-73
Family Ephrin receptor ligand binding domain 0.000000137
Further Details:      
 
Domain Number 2 Region: 592-684,725-839
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-42
Family Protein kinases, catalytic subunit 0.0000000931
Further Details:      
 
Domain Number 3 Region: 296-498
Classification Level Classification E-value
Superfamily Fibronectin type III 3.9e-22
Family Fibronectin type III 0.0000903
Further Details:      
 
Domain Number 4 Region: 873-940
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.28e-20
Family SAM (sterile alpha motif) domain 0.00025
Further Details:      
 
Domain Number 5 Region: 226-299,334-354
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000051
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007088   Gene: ENSTGUG00000006852   Transcript: ENSTGUT00000007157
Sequence length 941
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:6081016:6131059:-1 gene:ENSTGUG00000006852 transcript:ENSTGUT00000007157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMDTRTATAELGWTANPPSGWEEVSGYDENLNTIRTYQVCNVFEPNQNNWLLTTFINRRG
AHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSKSAFWTEAPYLKVDTIAADESF
SQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDYGACMSLLSVRVFFKKCPSVVQNFAIF
PETMTGAESTSLVTARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKAGYEPENNVA
CKACPAGTFKASQGAGLCVPCPPNSRSTAEASPLCACRNGYYRADFDPPAAACTSVPSGP
RNVISIVNETSIILEWHPPRETGGRDDVTYNIVCKKCRSDRRACSRCDDNVDFVPRQLGL
TDTRVFISNLWAHTPYTFEIQAVNGVSSKSPFPQQHVSVNITTNQAGERRVVPECGCPAA
GCKLRAQKGRTPSCPQQGQLGCVPPDHNEYNSSMARSQTNTARLEGLRPGMVYVVQVRAR
TVAGYGKYSGKMCFQTLTDGECGLAVPPARPPALGDERSMSAQPNLCPRAAWREPGDLRR
CLVNRPREERSALHLLAPGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAG
EFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVT
KSRPVMIITEFMENGALDSCLLQDVLLPSIPCVPAEPGRRVLDVQSAMGGKVRAVVSTNY
PFSSSFLEQVQDRFMQLFLAPASLSHQGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMW
EVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNTRPRFTEIV
NTLDKMIRNPASLKTPLGASQVPSQPLLDRSIPDFTAFTSVDDWLSAVKMSQYRDSFLTA
GFTSLQLVAQMTSEDLLRIGVTLAGHQKKILNSVQSMRVQM
Download sequence
Identical sequences H0Z935
ENSTGUP00000007088 59729.ENSTGUP00000007088 ENSTGUP00000007088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]