SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007114 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007114
Domain Number 1 Region: 1919-2074
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.21e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000312
Further Details:      
 
Domain Number 2 Region: 1765-1919
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.27e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000167
Further Details:      
 
Domain Number 3 Region: 9-196
Classification Level Classification E-value
Superfamily Cupredoxins 1.77e-45
Family Multidomain cupredoxins 0.0000286
Further Details:      
 
Domain Number 4 Region: 377-565
Classification Level Classification E-value
Superfamily Cupredoxins 1.56e-44
Family Multidomain cupredoxins 0.0000389
Further Details:      
 
Domain Number 5 Region: 1621-1765
Classification Level Classification E-value
Superfamily Cupredoxins 5.24e-42
Family Multidomain cupredoxins 0.0000983
Further Details:      
 
Domain Number 6 Region: 1445-1610
Classification Level Classification E-value
Superfamily Cupredoxins 1.43e-36
Family Multidomain cupredoxins 0.0000309
Further Details:      
 
Domain Number 7 Region: 572-711
Classification Level Classification E-value
Superfamily Cupredoxins 6.86e-36
Family Multidomain cupredoxins 0.00018
Further Details:      
 
Domain Number 8 Region: 205-338
Classification Level Classification E-value
Superfamily Cupredoxins 1.72e-32
Family Multidomain cupredoxins 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007114   Gene: ENSTGUG00000006867   Transcript: ENSTGUT00000007184
Sequence length 2079
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:19757465:19782329:-1 gene:ENSTGUG00000006867 transcript:ENSTGUT00000007184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLVEEGIGKVRRFYIAAVETAWDYTHSDLLSVLQAPAGILGHAGPRPPPAGVPPRYRKA
VFVEYPDSSFTQPKLKPAWMGLLGPTIRAEVHDTVVITFKNLASRPYNLHAVGVSYWKAS
EGAGYEDETSQPEKEGDRVDPGKTHTYVWEIQENQGPTDDDSACLTHSYSSNTNSVKDIN
SGLIGALLVCRPGTLASDENEGPQKEFVLLFAVFDEGKSWYSEQSSPAGAQPPAHNRTEL
HTINGYINGSLPGLTLCLKKQVHWHVIGLGSGPEVHSIFFEGHTFLVRSHRLGSLEISPA
TYLTAQTTPGTAGWFRMFCQILSHQQVGMEAFVKVEECPEERLLKMGKLLNEPEDVDYPE
EDEESYHVIQVRSFAKDRPVTWTYYIAAEEMDWDYAPLKPVSLDRNMASLYLEPGPQQIG
SKYKKVVFVEYEDATFKKRKVSNQQDKGILGPVIKGEVGDQFKIVFRNLASRPYNIYPHG
LTSVRPYYAMRPSQEKDVKYIPIAPGKSFTYSWSLTTEDGPTEADPRCLTRFYYSSIDPL
RDTASGLIGPLLICSKKSMDQRGNQIMSDNMKLVLFSVFDENHSWYLEDNIKRFCSDAAH
VDTQDPQFYASNVMHTINGFVFDNFQTKLCLNHVVYWYVLSVGAQTDFLSIFFSGNTFKH
NMVFEDVLTLFPFSGETVVMSLEKPGVWTLGCLNPDFRDRGMHAKFTVSQCQYEQYTGEE
DYVYPEEEDVFEFQPRGFSKRKKSCVNEQLNNITSSRNEIAKTRLCLTEHGALLSNGTTS
DPSSNSTSTFLGTMPNPHDISASSLPEMSYDPVSYDVSGRVHGTVSSEEDQQWLHQATAA
PGDALAGMKVRKISELQEPVKGMTVQSGGRVENLEAEPQKTTIPPTSLWDSIAYAAGKAP
LQENRSSIHQNDLEHNLALQDVSSQGNEDKLLNRADKISFNLYDSGETISTAPSLSIDHN
SSSTLSNPSASPDGTEDNRTSHAVVPSHTIESKASQRPHKVVSQDFYETSEEQNVSLSDK
ALPGEIFTDESLLDTTSADTNELEPSSYVMTEERDEVILKEMFQDAKELAELDSIAFYES
NVVTNDTRPFPSGFLKSSEQFLRHRVTARSTNGPDRRPEQARSLESRGLGLPNISSRKPL
PDGKTTEQDPQRRADLIPHFASLTSKRAPQSLEGKSNMVERRLHAGRDAVQADEMHPEGR
LSTDRGVQGSRDGAQHSRDSFPSQGALGTGSAVTAEAADLASNWEPVSPGAVVNMGGLAQ
PSSGRAAARQSCGLWGASESEQAQGRSHMEGGDKLCGAAGLGQCHRGPCAWENVWAKPRR
NVSEISHQRELSPPHNNSTKKPAEYVQDTPQGCQVLGREDILREIGKTEGQGLGEPNEDV
ESNSTAGQRSHIPGQRDEPDLNNGTHSSPSRTAKTDYDEYSATEQTMEDFDMYGEEEHDP
RSFQGEIRQYFIAAVEVMWEYGDQRPQHFLKAISRRKHSWQYRKVVFREYLDDSFTQPVQ
RRELDEHLGILGPYIRAEVQDVIMVTFKNLASRPFSFHSTLTAYEGTTQQGGVVQPGGHQ
KYSWKVLHQMAPTTQEFDCKAWAYFSNVDLEKDLHSGLIGPLIICKQGVLSYVSRRQLAV
QEFSLLFTIFDETKSWYFPENVDRNCRPPCQLQQDSPDFKRNHSFHAINGYVSDTLPGLV
MAQQQRVRWHLLNMGSTEDIHSVHFHGQLFNVRTSQEYRMGVYNLYPGVFGTVEMWPSHA
GIWRVECKVGEHQQAGMSALFLVYDLNCRNALGMASGGIADSQITASGQYGQWAPYLARL
GNTGSINAWSTERSNAWIQVDLLHPTIIHGIKTQGARQKFSSFYISQFVVFYSLDGRRWK
TYKGNATSTQMLFFGNVDANGVKENRFNPPVVARYIRIHPTHYNIRATLRMELLGCDLNS
CSMPLGMENRGIPDEHISASSYSANIFSRWTPALARLNLQGRTNAWRPKSNSPREWLQVD
FEVTKKVTAIITQGAKALFTEMFVKEFAVSISQDGTHWSPVLQNGKEKIFKANRDHQSTV
RNTLESPLFARYVRIHPRQWHNHIALRLEFLGCDTQQEY
Download sequence
Identical sequences H0Z961
ENSTGUP00000007114 ENSTGUP00000007114 59729.ENSTGUP00000007114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]