SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007163 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007163
Domain Number 1 Region: 481-739
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-80
Family Eukaryotic proteases 0.00034
Further Details:      
 
Domain Number 2 Region: 145-248
Classification Level Classification E-value
Superfamily SRCR-like 4.32e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000082
Further Details:      
 
Domain Number 3 Region: 253-354
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 4 Region: 363-464
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 5 Region: 50-136
Classification Level Classification E-value
Superfamily SRCR-like 1.2e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0023
Further Details:      
 
Domain Number 6 Region: 1-36
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000227
Family Kringle modules 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007163   Gene: ENSTGUG00000006930   Transcript: ENSTGUT00000007233
Sequence length 740
Comment pep:novel chromosome:taeGut3.2.4:6:14810924:14822418:-1 gene:ENSTGUG00000006930 transcript:ENSTGUT00000007233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNFCRNPDGGTTPWCFYRLVSGAIGWANCDCNQGKGCAASGLKPEMYSSVELYFNGLWGT
ICADHWTDWDASVVCRQLGLSEIGTAGKKSHSRPWPVPLHLQSANCHGDEEALLQCGYQE
ALSGSCNQGSAVVTCYFLGGGVGAPLRIVGGKESFEGRVEVYHDGKWGTICDDQWDDRDA
EVVCRQLGLSGTPKALSWAHYGQGSGPILLDEVQCSGNELSLDQCKKSDWGQQNCDHIED
AGVSCDPFTEGMVRLAGGRSPSEGRVEVYYNGDWGTVCDDGWTDLGAQVVCRQLGFSLGQ
EATRDYASGQGFILLDDVACVGTELSLLDCPHSNWGQHDCSHVEDLGVRCSPESNTFHLL
VWPPVRLVDGESTKEGRVEVLLNGQWGSVCDDDWTDRDATVVCTQLGFSGTAKARSMAYF
GEGHGPIHLENIECSGMEHALGQCATPDTRIHSCWHSEDAGVICDYVEEKVQDIRRTGPE
SGVCGMRLLHRRKKRIIGGNKSLRGSWPWQASLRLKGFRRDTRLLCGATLISSCWVVTAA
HCFKRFGVDVRRYLLRVGDYHTGVKDEFERELPVERIVLHRNYWAGSNDNDIALVRMRGR
EGHCLSFNHHVLPICLPDRRERSDINRQACIISGWGDTGKSYSRTLLQGVVPLLPREDCE
ARYGQKFTNRMICAGNLSEDKRVDSCQGDSGGPLMCQRSNGRWIILGITSWGYGCGRKDS
PGVYTKVSKFVPWIKKVTKL
Download sequence
Identical sequences H0Z9B0
59729.ENSTGUP00000007163 ENSTGUP00000007163 ENSTGUP00000007163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]