SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007170 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007170
Domain Number 1 Region: 360-601
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-91
Family Eukaryotic proteases 0.00000126
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007170
Domain Number - Region: 12-80
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00141
Family Pan module (APPLE domain) 0.023
Further Details:      
 
Domain Number - Region: 111-135
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00177
Family Pan module (APPLE domain) 0.026
Further Details:      
 
Domain Number - Region: 202-226
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0155
Family Pan module (APPLE domain) 0.03
Further Details:      
 
Domain Number - Region: 280-320
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0765
Family Pan module (APPLE domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007170   Gene: ENSTGUG00000006947   Transcript: ENSTGUT00000007240
Sequence length 601
Comment pep:novel chromosome:taeGut3.2.4:4:39354388:39366639:1 gene:ENSTGUG00000006947 transcript:ENSTGUT00000007240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECVTQSYENTFFQGGDLTTVFTPSANYCQIVCTYHPTCLLFTYLPATWTKDPAKRFSCYL
KDSDTEMLPKLDMEGAISGHSLKQCNQISACSPDVHVGLDMEGNIFDITVADSYQECQKR
CTNDNRCHFFTYASETFHNASFCKKCFLKHASIGTPTSIKVLDEVVSGFSLKPCQLSELD
CQMDIFEDQVFSGINITSFFTPDISVCQTICTYFPKCLFFTFFTRKWQIESQRNLCLLKT
STSGIPEELISQENAVSGFGLLNCRRSFPACNSRTYMQMDFLGDELTVTYTKGHRACQQV
CTDMIRCQFFSYSLFQDSCNEEGKCECHLRMSSDGSPVKIVHGPGSISGYSLRLCKKKAS
TGKTIRIVGGTDSSPGEWPWQVSLHARLSRQRHLCGGSIISNQWVLTAAHCVTSLENPNI
WRIYAGILRQSEINEDTPFFKVEEIIVHSQYKYAWIGYDIALMKLAEPMNFTDLQQPICL
PSKEDTNIFYTECWVTGWGYRKEKGRVQDILQKAPVPFMSKEECQARYWKHRIGDKVICA
GYDEGGRDACKGDSGGPLSCRHEEVWYLVGITSWGEGCARPRQPGVYTKVADYADWILEK
T
Download sequence
Identical sequences H0Z9B7
59729.ENSTGUP00000007170 ENSTGUP00000007170 ENSTGUP00000007170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]