SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007213 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000007213
Domain Number - Region: 11-50
Classification Level Classification E-value
Superfamily UBA-like 0.0612
Family CUE domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007213   Gene: ENSTGUG00000007013   Transcript: ENSTGUT00000007284
Sequence length 630
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:10283061:10297852:1 gene:ENSTGUG00000007013 transcript:ENSTGUT00000007284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSQQLDVQVLHDLRQRFPEIPEGVVSQCMLQNNNNLDACCRALAQESSKYLYMEYHS
PDDTRMNRNSLLHINLGIHPHTSYHAGDGAQLNGGRTLVHSSSDGHIDPQRTAGKQLICL
VQEPHSAPAVVAASPSYNPFFVNDQNRNAATPPPQPPPQPSSIQPGMNTSAMQGPPTYMH
IPRYSTNPITVTVSQNLPSGQSVPRALQILPQIPSNLYGTPGSIYIRQTSQSSSGRQTPQ
NTQWHSSPQGPVPHYTPRPLPVYPHQQNYQPSQYSPKQPQIPQSAFRSPPASQCPSPFGS
PQHQVQPPQLSHQSSHVFMPPSPSTVPPHPYQQASQTFQKQGGHSVSYLPPFAGPSLSKG
SMNKIEITVEPPQRPGTAMNRSPSPISNQPSQRNQHPLYTATTPPSSSPSRGMSGQPKPP
FSVNPVYITYTQPAGPAGAPTQSPRVMVSQPNPTIFKITVGRAPTENLLNLVDQEERSAA
PEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKELKLEKEE
LERLKTEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSLNRQLQINVDCTLKEVDLLQ
SRGNFDPKATCNFYDNIEPGPVVPPKPYKK
Download sequence
Identical sequences H0Z9G0
ENSTGUP00000007213 ENSTGUP00000007213 59729.ENSTGUP00000007213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]