SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007223 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007223
Domain Number 1 Region: 2743-2943
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-38
Family Laminin G-like module 0.0054
Further Details:      
 
Domain Number 2 Region: 2154-2258
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-32
Family Cadherin 0.00095
Further Details:      
 
Domain Number 3 Region: 2260-2371
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-32
Family Cadherin 0.00075
Further Details:      
 
Domain Number 4 Region: 63-191
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-31
Family Cadherin 0.0014
Further Details:      
 
Domain Number 5 Region: 1210-1316
Classification Level Classification E-value
Superfamily Cadherin-like 2e-29
Family Cadherin 0.00081
Further Details:      
 
Domain Number 6 Region: 492-594
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-28
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 1950-2058
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-26
Family Cadherin 0.00092
Further Details:      
 
Domain Number 8 Region: 1737-1843
Classification Level Classification E-value
Superfamily Cadherin-like 8.28e-26
Family Cadherin 0.00097
Further Details:      
 
Domain Number 9 Region: 695-815
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 1005-1112
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 11 Region: 1845-1956
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 12 Region: 380-490
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 13 Region: 2364-2468
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 14 Region: 596-717
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 15 Region: 1420-1530
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-20
Family Cadherin 0.0023
Further Details:      
 
Domain Number 16 Region: 1518-1626
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-20
Family Cadherin 0.0019
Further Details:      
 
Domain Number 17 Region: 803-928
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 18 Region: 1318-1416
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 19 Region: 1115-1217
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-18
Family Cadherin 0.0017
Further Details:      
 
Domain Number 20 Region: 293-392
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-18
Family Cadherin 0.0067
Further Details:      
 
Domain Number 21 Region: 2052-2153
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-17
Family Cadherin 0.001
Further Details:      
 
Domain Number 22 Region: 169-282
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-17
Family Cadherin 0.0041
Further Details:      
 
Domain Number 23 Region: 3-74
Classification Level Classification E-value
Superfamily Cadherin-like 2e-16
Family Cadherin 0.0032
Further Details:      
 
Domain Number 24 Region: 914-1017
Classification Level Classification E-value
Superfamily Cadherin-like 4e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 25 Region: 1634-1735
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000003
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 3058-3095
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 27 Region: 2474-2562
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000928
Family Cadherin 0.016
Further Details:      
 
Domain Number 28 Region: 2985-3021
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 29 Region: 3024-3063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000326
Family EGF-type module 0.012
Further Details:      
 
Domain Number 30 Region: 2945-2983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007223   Gene: ENSTGUG00000006987   Transcript: ENSTGUT00000007294
Sequence length 3519
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:39733585:39831770:-1 gene:ENSTGUG00000006987 transcript:ENSTGUT00000007294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDGEIRYSIRDGSGIGVFRIDEEKGIIETADHLDRETTSHYWLTVYATDQGVVPLSSFIE
IYIEVGDVNDNAPQTTEPVYYPEVMENSPKDVSVIQIEAFDPDSSSSEKLSYKITSGNPQ
GFFSINPKTGLITTTSRKLDREQQGEHILEVTVTDNGTPAKSTIARVIVKVLDENDNKPQ
FLQKFYKIRLPERGKPERERTARREPIYRVIAADKDEGPNAEISYSIEDGDEHGKFFIEP
KTGVVSSKKFSAARDYDILSIKAVDNGRPQKSSTTRLHIEWIPKPIPPTEPIYFEESFFS
FTVMESDPVAHMIGVIAVEPLGTPLWFDITGGNYDSRFDVDKGTGTIIVARPLDAEQKSN
YNLTVEATDGTRSISTQVYIKVIDTNNHRPQFSASKYEVVIPEDTLPETEILQVSATDRD
EKNKLIYTIQGSTDPISLKKFRLDPATGSLYTSEKLDHETMNQHILTIMVRDQDVPVKRN
YARVVVNVSDTNDHAPWFTSPAYEGRVYESAAVGSAVLQVTALDKDKGKNAEIVYSIESG
NIGNSFLIDPILGMIKIAKELDRSNQEEYNLMVKATDKGHPPMSEVTSVHIFVTVSDNAS
PKFTAKEYSTEISESANIGSFVGMVTAYSQSSVVYEIKDGNTDDAFAINPNSGVIVTQKI
LDFETLPFYALTVQGTNMAGLSSNATVLVHLQDENDNPPVFMQAEYTGLISESASINSVV
LTDKNIPLVIRAADADKESNALLVYQIVEPSVRQYFAIDSSTGAIRTVMSLDYEETNIFH
FSVQVHDTGIPRLYAEYAANVTIYVIDINDCPPVFSRELYETSLLVPTYKGVKVIGVNAT
DADSGIFSQLIYSIIEGNIGEKFSINPKTGDITVQNTTQLRSRYELTVRASDGRFASTAS
VKINVKESKASQLKFTQSSYSATVQENSTEAKTIAVVSAIGNQINKPLFYHILNPDSRFK
ISQTSGVLSTTGIPFDREQQESFDVVVEVTEENKPSVVAHIVVKVTVEDVNDNVPFFVNL
PYYAAVKVDSEAGHIIQRVTAVDKDTGKNGEVRYYLKEHNEHFQIDPTGEISLKKKFEPD
TLNKEYLVTVVAKDGGDPAFSAEVTVPITVMSKAMPVFEKPFYSSEIPENIQLHSPVVHV
QANSPEGLVFYSITGGDPFNQFTINFNTGINVVAPLDFESHPAYKLSVRATDSLNGAHAD
VFVDIIVEDINDNPPVFTEQSYIATLSEASVIGTSVAQVSATDADSGTNRGISYHLVEDN
SESHDYFHIDSSTGLILTAKTLDYEQIKQHKLLIRAVDGGMLPLSSDTIVTVDVTDLNDN
PPLFSQLLYEAKISELAPRGHFVTCVQASDADSSDADKLEYSILTGNDQKNFVINSKTGI
ITISNLRRQTLKSHYKLNVSVSDGVFRSSAQVHITVISANMHSPVFSQNEYEVELAENSP
LHTLVTEVKATDEDSGTHGHITYHIVNDFAKDRFYTNERGQIFTAEKLDRETQAEKVIAI
SLMAKDSGGKVAFCTVNVILTDDNDNAPQFRATEYEVNIGTDVPRGTSVIKVWASDADEG
TNADITYSIEAESDNVEENLEIDSLSGIITTKESLIGLENEFLTFLVRAIDGGSPQKESV
VPVYARILPPEVPTPKFSEPFYSYTVSEDIPIGTVIDVIKADHNQTLVYSLIKGNTPESN
RDDFFVIDRQTGELKLEKNLDHETTKWYQFSVQAQYANEDYNVVSSVEVSIQVKDANDNQ
PILESNPYEAFIVENTPAGTRVIQVKGTDLDSGLNGQVTYSLSFSELDIIESFTINMETG
WITTLKELDHEKRDKYKIIVVASDRGEKIQLSSMAVVEVTVTDVNDNPPRFTAEIYKGTV
SEDDPPGGVIAILSTTDADTEETNRQVFYYITGGDPLGQFAIENIQNEWKVYVKKPLDRE
EKDNYLLNITATDGTFAAKAVVEVKVLDANDNSPVCEKTLYADSVPEDALPGKLIMQVSA
TDADIRSNAEITYTLHGTGAEKFRLTPDTGELKTLMALDREQQAVYHLLVKATDGGGRFC
QANIILTLEDVNDNAPEFTTDTYSITVFENTEPGTLLTRVQATDADAGMHSLTDILLLKY
IFCMLEDIPIVSLQKRGEREETKSVYTLTLKATDEGLPRRLSSTSSLIVSVLDINDNPPV
FEQREYSASVSEDILVGTEVLQIHAASRDIEANAEITYSIVSGNEHGKFSIDSTTGAIFI
IESLDYESSHEYYLTVEATDGGTPSLSDVVTVNINVTDINDNSPVFSQDTYTAVISEDAM
LEQSVITVMADDADGPSNNRVHYTIIDGNQGNPFTIDPTRGEIKVTKLLDREKISGYTLT
VQASDNGSPPKLNTTTVNIDVSDVNDNPPVFSKGNYSVIIQENKPVGFSVLQLVVTDRDS
SHNGPPFLFNILTGNEEKAFQITQQGVLTTSAALNRKVRDHYLLHVKVADNGKPPLSSLT
YIDIRVIEESIYSPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLTYSLDPKMESL
FSVSSTGGKLIAHKRLDIGQYLLNVTVTDGKFTTAADITVHIRQITQEVLNHSIAIRFAN
LSPEEFIGDYWRNFQRALRNILGVRRNDIQIVSLQPSDPPSNLDVLLNIEKSGSSHHPTR
ILLHKINSSVPDLEEILGVRIIDVFHKLCAGLDCPLKFCEEKVTVDENIMSTHSTARLSF
VTPRHHRTAVCLCKEGKCPLVNSVCEGNPCPEGTKCLGDPKEGKYTCVCQDSKAGQCPAG
SAVTFTGSSYVKYRLMESENKEEMKLTMRLRTYSAHAVVMYARGTDYSILEIHHGRLQYK
FDCGSGPGIVSVQSTQINDGQWHSISLEVDGNYARLVLDRVHTASGTAPGTLRTLNLDNH
VFFGGHIRQQGTRHGRSPQVSNGFRGCMDSIVLNGQELPLNSKPRNYAHMEESVDVTPGC
LLTATDGCSSSPCQNGGICNALSNGGIYLKSCAPLFMGTHCDVSVNPCASNPCLYGGTCI
PVSDDFICQCRGQYTGQRCQLGPYCKDNPCKNSGKCIDSLDGPVCECEAGFRGERCLTDV
DECVENPCLNGALCENTYGSYHCNCSRGFGGKHCTDIVLNKYVSTSWNISLAEVIGIIVF
VTGIFLLVVIFVVCRKVVGRKKKHQPEPEDKQLGATTAFLQRPCFDAKLNKNIYSDIPPQ
VPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDSVHGHRKAVAVCSVAPNL
PPPPPSNSPSDSDSIQKPSWDFDYDTKVVDLDPCLSKKPLDEKNSHPYSARESMSEVQSL
SSFQSESCDDNGYHWDTSDWMPSVQLPGIQEYPNYEVVEESAPLYTDPNAIDTDYYPGGY
DIESDFPPPPDDFPAPDELPPLPPEYSDQFESIQPPRDMPAVGSLGSSTRSRQRFNLNQY
LPHHYPADMSEPQTSPRGGSGSYREPYAPYSLGFNPDFEAPTVDSMSMSVYASTASCSDV
SACCEMESEVMMSDYESGDDGHFEDVKIPPLDSQQHTEV
Download sequence
Identical sequences H0Z9H0
ENSTGUP00000007223 ENSTGUP00000007223 59729.ENSTGUP00000007223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]