SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007229 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000007229
Domain Number - Region: 125-194
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00538
Family UBX domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007229   Gene: ENSTGUG00000007022   Transcript: ENSTGUT00000007300
Sequence length 1120
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:12865230:12901443:-1 gene:ENSTGUG00000007022 transcript:ENSTGUT00000007300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKAPPPPSETKSIAVSPFDSTEPTNLIMEQKENVIDKDIELSVVLPGDVIKYTTVNGRK
PMMDLLIFLCAQYHLNPSSYTIELVSAENSQIKFKPNTPVGMLEVEKVIVKAKQMDKKKP
APVIPEQTVRVVINYKKTQKTVVRVSPHSPLQELIPIICSKCEFDPSHTLLLKSYQSQEP
LDMTKSLNDLGLRELYAMDITQGSYQSENIDVLKEKENKGFFSFFQRNKKKREQPHLKAA
SAPATPLMSKPRPTFIMRSNTVSKQYDSSTLPAEMPKKRRAPLPPMPSSQSAPQELAGAQ
GRPASDIQIIFLPCLPWQAPVGLVRKGSLPLSDSASVNSSLRRMKRKAPSPPSRAPEDQS
ESSNEPVTESTESASTKAEGRATEMQPETVTVDVRSSEYNLEEIDEREEMGVQQGEDSGS
TNTSPGIGEVIAAFSSTEVSLENDKNDPASSAPVPGSVPTDNSQSFKEEKQENMSTDGKG
LQTKISSEDAGFQTDRKLKILGQNKTDEDHSDTKLLPTTEEGKEFQTAKIKTVDFRENNK
LEVDRLSNCQACKNDTSVSHRNYPQLISEKQDGKRNATALDTIKTQDVGIQTLDSNLGRT
AQKEITVPQGVESSTFRKLVPQDNRDKNSSLAQEMHGMHQESGDTSIEQNLKTQEVTHKK
VISIEDQSHICINGSDFASPETTAENPDDSPVKDKPFYRQDTKPKPKPANEITRDYIPKI
GMTTYKIVPPKFLEIMKSWESEVPSDHKDQEVSTLEDPKEFIVQTEIPHLSESVGPLQVG
SQNEAAAANGVLQRVNSISEHTVTSGAEITTESNQMERESFRQPVQLMLNLDNTNASSET
QDKSNALSPLSPTMKPSSFYLQMQRRASGHYVTSAVARSTVCAPNSIQNEVKNTEMGKKI
SSSDLTSLALQKTNIPSPPADQEKVDDGKITEPSTSPVKSNKPLNVPSCPPAPLNLKTLR
TFAVPKPYSSSRPSPFALAVSSAVKRSQSFNKTRTITSQAPTGFSSATSMPEVKSPSLQT
VTTGSQNSLMDKKGSHVHSEQQSQAQSGASPDHPRPVTKRQTAMTLPRADPEQIHQSLLA
AIRSGEAAAKLKRVGPPSNTIAVNGRAKLNPLYSTEAKAN
Download sequence
Identical sequences H0Z9H6
ENSTGUP00000007229 ENSTGUP00000007229 59729.ENSTGUP00000007229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]