SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007238 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007238
Domain Number 1 Region: 1-81
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000189
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007238   Gene: ENSTGUG00000007033   Transcript: ENSTGUT00000007309
Sequence length 82
Comment pep:known chromosome:taeGut3.2.4:9:6476387:6482616:-1 gene:ENSTGUG00000007033 transcript:ENSTGUT00000007309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVFQAWCGPCKPVVNLFQKIKNEVGSNLLHFAVAEVDSIDALEKYRGQCEPVFLFYTGG
ELVAVVRGADAPLLQKTILKQL
Download sequence
Identical sequences H0Z9I5
ENSTGUP00000007238 ENSTGUP00000007238 59729.ENSTGUP00000007238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]