SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007289 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007289
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.88e-34
Family Ubiquitin-related 0.000024
Further Details:      
 
Domain Number 2 Region: 105-159
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 5.49e-21
Family Ribosomal protein S27a 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007289   Gene: ENSTGUG00000007086   Transcript: ENSTGUT00000007361
Sequence length 161
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:28389344:28390875:-1 gene:ENSTGUG00000007086 transcript:ENSTGUT00000007361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGPAMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
SDYNIQKQESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKIS
RLRRECPSEECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK
Download sequence
Identical sequences H0Z9N6
59729.ENSTGUP00000007289 ENSTGUP00000007289 ENSTGUP00000007289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]