SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007345 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007345
Domain Number 1 Region: 268-392
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-17
Family Second domain of FERM 0.0086
Further Details:      
 
Domain Number 2 Region: 181-262
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000682
Family Ras-binding domain, RBD 0.037
Further Details:      
 
Domain Number 3 Region: 55-110
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000242
Family PDZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007345   Gene: ENSTGUG00000007140   Transcript: ENSTGUT00000007418
Sequence length 403
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:72393787:72404820:1 gene:ENSTGUG00000007140 transcript:ENSTGUT00000007418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDLETSLIHTRKTCRIEQMVAKWLHRSRDSAARGSVAAMDSAGDGAAQPPSRAKVTVTV
YKDLVLQHYGFEICPGLPLTIASVTAGGSTVDGKLHPGDQLLMINSSMVEWAVCGTGGQL
HHVTPLLVGASTGRSGAGGPKSSFLTEEKRARLKTNPVKVRFAEEVLLNGHSQGSSLLFM
PNVLKVYLENGQTKAFRFERSTTVKDIVLTLQEKLSIRSIAHFALVLEEQYNLAKVHLLH
EEELIAQVVQKRDSHDYRCLFRVCFVPRDPLDLLQEDPVAFEYLYLQSCSDVLQGRFAPP
GLCPPLPCAALWGQRGWAPRAPFPLYARRDWGIENFISPTLLRNMRGKDIKKAISYHLKR
NQVLLDPRQKHALAAVQVRLSYLQILGELKMYSGKIFNATMMV
Download sequence
Identical sequences H0Z9U2
ENSTGUP00000007345 ENSTGUP00000007345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]