SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000007349 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000007349
Domain Number 1 Region: 749-1036
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-73
Family Protein kinases, catalytic subunit 0.00000000127
Further Details:      
 
Domain Number 2 Region: 478-656
Classification Level Classification E-value
Superfamily Fibronectin type III 2.67e-26
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 270-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000239
Family I set domains 0.02
Further Details:      
 
Domain Number 4 Region: 52-141
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000979
Family I set domains 0.047
Further Details:      
 
Domain Number 5 Region: 352-440
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000951
Family Fibronectin type III 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000007349
Domain Number - Region: 134-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000691
Family Growth factor receptor domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000007349   Gene: ENSTGUG00000007100   Transcript: ENSTGUT00000007422
Sequence length 1055
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:16355488:16366992:1 gene:ENSTGUG00000007100 transcript:ENSTGUT00000007422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNRSNQVQARGFSKADLVGILYCLGRTPTEQAQVVYVHNSHNAHLFPVKATQSVNVAEVA
TFSARILKRKETDVMWKRNGKTYYQTTDRGEVQDDHVVLTLPNVSVSENGVYSATFMGDS
PLWSAFYRLIVRACPAKKWGPSCEKDCPDCLNGGICHDHVGECICPPGFMGTRCERACQE
GQFGRNCQETCQRAQGCRGLSFCLLDPYGCSCASGWSGSRCDQACPSGFYGPDCALECAC
QNGGSCNRFSGCVCPAGWHGQHCEKSDRFPQIIQLASELEFNLGSEPIISCIAIGNPLPT
RDSVELRKADGTVLKVIKTIIEPKQITCEFEVRHLSKADTGLWECRVSTTGGQDSRKVKV
NIRVPPVPLSAPRLLAKQSRQLVVSPVDSFSGDGPITSIKLFYKPKDDNSAWSSIVVDNS
ENITLMNLRPVTAYIVKVQLSRPGAGGEGSKGPEAIMVTDCLEPTVKPVIEGWSIEEKNM
LHVNWKLPSNHEPAHGFIVHLFDSARRLVSEKNITSISVLSARIEDLEFNKEYRLEVLVY
HCTSLGPPSDPYKVMINSKGPSSPQLLSAEPVSDTAVRLSWQVPEYPNGGITKYIVELQQ
VGSTSEPQWIDTDSGAETTKIVGGLNSSTSYQFRVRANSHVPGEWSLPVKAKTFGDVLSV
PPSLGSQSTEQAGTDQQLLLAIVGSVSVTCFTILFALLALFLIKKNFFHRRRTFTYQSGS
GEETILQFNSGTLTLTRRPKPQPEPLSYPILEWEDIKFEDMIGEGNFGQVIRAMIKKDGL
KMNAAIKMLKEFASENDHRDFAGELEVLCKLGHHPNIINLLGACENKGYLYIAIEYAPYG
NLLDFLRKSRVLETDPAFAKEHGTASTLTSQQLLQFASDVAKGMQYLSEKQFIHRDLAAR
NILVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLL
WEIVSLGKALPCPLPSLREHPRDCHLLSLCKPRNCDDEVYELMRQCWRDRPYERPPFAQI
SMQLIRMLEARKAYVNMALFENFTYAGIDATAEEA
Download sequence
Identical sequences H0Z9U6
ENSTGUP00000007349 59729.ENSTGUP00000007349 ENSTGUP00000007349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]